BLASTX nr result
ID: Akebia24_contig00039618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00039618 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212333.1| hypothetical protein PRUPE_ppa014316mg [Prun... 73 5e-11 >ref|XP_007212333.1| hypothetical protein PRUPE_ppa014316mg [Prunus persica] gi|462408198|gb|EMJ13532.1| hypothetical protein PRUPE_ppa014316mg [Prunus persica] Length = 74 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = -1 Query: 283 PPYDRYQREAFSYTIVASLLLCFGIRGSKASTSK*KLPGKASNKEVGLNL 134 PPYDRYQREAFSYTIVASLLLCFGIRGSKASTS+ K K +G +L Sbjct: 25 PPYDRYQREAFSYTIVASLLLCFGIRGSKASTSR-SFLAKLQTKRLGCSL 73