BLASTX nr result
ID: Akebia24_contig00038622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038622 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESZ98905.1| hypothetical protein SBOR_0763 [Sclerotinia borea... 58 1e-06 >gb|ESZ98905.1| hypothetical protein SBOR_0763 [Sclerotinia borealis F-4157] Length = 402 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/57 (49%), Positives = 33/57 (57%) Frame = +1 Query: 115 MSLTIKHLNGDAXXXXXXXXXXXXXXXXNASSNTFTVVLDPWLDGVSKIWHQKFSVS 285 MSLT+KHLN DA SN FT++LDPWL G SKI+H KFS+S Sbjct: 1 MSLTVKHLNNDASFLLTFEPISPFPPSPGRPSNYFTILLDPWLSGPSKIFHSKFSIS 57