BLASTX nr result
ID: Akebia24_contig00038594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038594 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526570.1| brca1 associated ring domain, putative [Rici... 61 1e-07 ref|XP_007050203.1| Breast cancer associated RING 1, putative is... 57 3e-06 ref|XP_007050201.1| Brca1 associated ring domain, putative isofo... 57 3e-06 >ref|XP_002526570.1| brca1 associated ring domain, putative [Ricinus communis] gi|223534131|gb|EEF35848.1| brca1 associated ring domain, putative [Ricinus communis] Length = 744 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 11/67 (16%) Frame = +1 Query: 106 MAESARHTQFI---NPWVLHLQKMGLELKCPL*FVSLWR--------YFHSSCILDSKEF 252 MA+S +H I NPWVLHLQK+GLELKCPL L R F +SC+ + +F Sbjct: 1 MADSMKHNSVIRSMNPWVLHLQKLGLELKCPLCLNFLKRPFLLPCDHIFCNSCLHERTKF 60 Query: 253 TSDCPIC 273 S+CP+C Sbjct: 61 ASECPVC 67 >ref|XP_007050203.1| Breast cancer associated RING 1, putative isoform 3 [Theobroma cacao] gi|508702464|gb|EOX94360.1| Breast cancer associated RING 1, putative isoform 3 [Theobroma cacao] Length = 501 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 9/55 (16%) Frame = +1 Query: 136 INPWVLHLQKMGLELKCPL*FVSLWR---------YFHSSCILDSKEFTSDCPIC 273 +NPWVLHLQK+GLELKCPL + L++ F SCI+ S EF +CPIC Sbjct: 13 MNPWVLHLQKLGLELKCPL-CLDLFKQPSLLPCDHLFCDSCIVRSAEFGPECPIC 66 >ref|XP_007050201.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] gi|590715461|ref|XP_007050202.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] gi|508702462|gb|EOX94358.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] gi|508702463|gb|EOX94359.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] Length = 684 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 9/55 (16%) Frame = +1 Query: 136 INPWVLHLQKMGLELKCPL*FVSLWR---------YFHSSCILDSKEFTSDCPIC 273 +NPWVLHLQK+GLELKCPL + L++ F SCI+ S EF +CPIC Sbjct: 13 MNPWVLHLQKLGLELKCPL-CLDLFKQPSLLPCDHLFCDSCIVRSAEFGPECPIC 66