BLASTX nr result
ID: Akebia24_contig00038550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00038550 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31022.3| unnamed protein product [Vitis vinifera] 136 3e-30 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-lik... 136 3e-30 ref|XP_004158693.1| PREDICTED: WPP domain-associated protein-lik... 128 9e-28 ref|XP_004134899.1| PREDICTED: WPP domain-associated protein-lik... 128 9e-28 ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-lik... 127 1e-27 ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 127 1e-27 ref|XP_006845998.1| hypothetical protein AMTR_s00155p00053970 [A... 126 3e-27 ref|XP_006367005.1| PREDICTED: WPP domain-associated protein-lik... 125 6e-27 ref|XP_004231564.1| PREDICTED: WPP domain-associated protein-lik... 125 6e-27 ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-lik... 123 2e-26 ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-lik... 122 4e-26 ref|XP_006377961.1| hypothetical protein POPTR_0011s16730g [Popu... 121 1e-25 ref|XP_006293684.1| hypothetical protein CARUB_v10022643mg [Caps... 120 1e-25 ref|XP_006468318.1| PREDICTED: WPP domain-associated protein-lik... 120 2e-25 ref|XP_006448888.1| hypothetical protein CICLE_v10014183mg [Citr... 119 4e-25 ref|XP_007213656.1| hypothetical protein PRUPE_ppa001247mg [Prun... 119 6e-25 ref|NP_181020.2| myosin heavy chain-related [Arabidopsis thalian... 119 6e-25 ref|XP_002879512.1| hypothetical protein ARALYDRAFT_482437 [Arab... 119 6e-25 ref|XP_004486461.1| PREDICTED: WPP domain-associated protein-lik... 118 1e-24 ref|XP_007022891.1| Early endosome antigen, putative isoform 1 [... 116 3e-24 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 136 bits (343), Expect = 3e-30 Identities = 68/83 (81%), Positives = 74/83 (89%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q L+ KA++ RR L YKQRLE+RYSDLQKAE EVDLLGDEVDALLSLLEKIYIALDH Sbjct: 718 QLTPLIQKANILRRTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIALDH 777 Query: 73 YSPILQHYPGVVEILKLIRRELS 5 YSPILQHYPGV+EILKL+RRELS Sbjct: 778 YSPILQHYPGVIEILKLVRRELS 800 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-like [Vitis vinifera] Length = 902 Score = 136 bits (343), Expect = 3e-30 Identities = 68/83 (81%), Positives = 74/83 (89%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q L+ KA++ RR L YKQRLE+RYSDLQKAE EVDLLGDEVDALLSLLEKIYIALDH Sbjct: 813 QLTPLIQKANILRRTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIALDH 872 Query: 73 YSPILQHYPGVVEILKLIRRELS 5 YSPILQHYPGV+EILKL+RRELS Sbjct: 873 YSPILQHYPGVIEILKLVRRELS 895 >ref|XP_004158693.1| PREDICTED: WPP domain-associated protein-like [Cucumis sativus] Length = 852 Score = 128 bits (321), Expect = 9e-28 Identities = 63/85 (74%), Positives = 73/85 (85%) Frame = -3 Query: 256 FQCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALD 77 F+ L+ AS+ +R L+YKQRLEKR SDLQKAEAEVDLLGDEVDALL LLEK+YIALD Sbjct: 762 FETKSLIQDASMVKRDGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIALD 821 Query: 76 HYSPILQHYPGVVEILKLIRRELSG 2 HYSPIL+HYPG+VE LKL++REL G Sbjct: 822 HYSPILKHYPGIVETLKLVKRELRG 846 >ref|XP_004134899.1| PREDICTED: WPP domain-associated protein-like [Cucumis sativus] Length = 881 Score = 128 bits (321), Expect = 9e-28 Identities = 63/85 (74%), Positives = 73/85 (85%) Frame = -3 Query: 256 FQCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALD 77 F+ L+ AS+ +R L+YKQRLEKR SDLQKAEAEVDLLGDEVDALL LLEK+YIALD Sbjct: 791 FETKSLIQDASMVKRDGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIALD 850 Query: 76 HYSPILQHYPGVVEILKLIRRELSG 2 HYSPIL+HYPG+VE LKL++REL G Sbjct: 851 HYSPILKHYPGIVETLKLVKRELRG 875 >ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-like [Solanum tuberosum] Length = 902 Score = 127 bits (320), Expect = 1e-27 Identities = 64/84 (76%), Positives = 75/84 (89%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q + LV KA+L RR L+Y+QRLEKR SDL+ AEAEVDLLGDEVD LLSL+EKIYIALDH Sbjct: 808 QLDCLVKKANLLRRTTLLYQQRLEKRCSDLKLAEAEVDLLGDEVDILLSLVEKIYIALDH 867 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSP+LQHYPG++EILKLI+REL+G Sbjct: 868 YSPVLQHYPGIMEILKLIKRELTG 891 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 127 bits (320), Expect = 1e-27 Identities = 64/84 (76%), Positives = 73/84 (86%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q + LV A+ RR L+YKQ+LE R SDL+KAEAEVDLLGDEVD LLSLLEKIYIALDH Sbjct: 814 QLSSLVQDANKLRRTGLMYKQKLEVRCSDLRKAEAEVDLLGDEVDTLLSLLEKIYIALDH 873 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPILQHYPG++E+LKL+RRELSG Sbjct: 874 YSPILQHYPGIMEVLKLVRRELSG 897 >ref|XP_006845998.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] gi|548848754|gb|ERN07673.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] Length = 907 Score = 126 bits (317), Expect = 3e-27 Identities = 63/80 (78%), Positives = 70/80 (87%) Frame = -3 Query: 241 LVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDHYSPI 62 LV A+ R+ L+YKQ LE+RYSDLQKAE EVDLLGDEVD LLSLLEKIYIALDHYSPI Sbjct: 822 LVRHANSLRKKNLLYKQGLERRYSDLQKAEVEVDLLGDEVDTLLSLLEKIYIALDHYSPI 881 Query: 61 LQHYPGVVEILKLIRRELSG 2 LQHYPG++EILKLI+REL G Sbjct: 882 LQHYPGIMEILKLIQRELKG 901 >ref|XP_006367005.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Solanum tuberosum] gi|565403106|ref|XP_006367006.1| PREDICTED: WPP domain-associated protein-like isoform X2 [Solanum tuberosum] Length = 916 Score = 125 bits (314), Expect = 6e-27 Identities = 63/84 (75%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q N LV K + RR L+Y+QRLEKR SDLQ AEAEVDLLGDEVD LL LLEKIYIALDH Sbjct: 826 QLNSLVKKTNSLRRTVLLYRQRLEKRCSDLQMAEAEVDLLGDEVDTLLRLLEKIYIALDH 885 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 Y P+LQHYPG++EILKLIR+EL G Sbjct: 886 YLPVLQHYPGIIEILKLIRKELWG 909 >ref|XP_004231564.1| PREDICTED: WPP domain-associated protein-like [Solanum lycopersicum] Length = 900 Score = 125 bits (314), Expect = 6e-27 Identities = 63/84 (75%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q N LV K + RR L+Y+QRLEKR SDLQ AEAEVDLLGDEVD LL LLEKIYIALDH Sbjct: 810 QLNSLVKKTNSLRRTVLLYRQRLEKRCSDLQMAEAEVDLLGDEVDTLLRLLEKIYIALDH 869 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 Y P+LQHYPG++EILKLIR+EL G Sbjct: 870 YLPVLQHYPGIIEILKLIRKELWG 893 >ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Glycine max] Length = 854 Score = 123 bits (309), Expect = 2e-26 Identities = 59/77 (76%), Positives = 70/77 (90%) Frame = -3 Query: 232 KASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDHYSPILQH 53 KA++ + M +VYKQ+LE + SDL KAEAEVDLLGDEVD LLSLLEKIYIALDHYSPILQH Sbjct: 772 KANVLKTMGMVYKQKLETKSSDLSKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQH 831 Query: 52 YPGVVEILKLIRRELSG 2 YPG++EIL+L+RREL+G Sbjct: 832 YPGIIEILELVRRELTG 848 >ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-like [Glycine max] Length = 854 Score = 122 bits (307), Expect = 4e-26 Identities = 60/77 (77%), Positives = 70/77 (90%) Frame = -3 Query: 232 KASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDHYSPILQH 53 KA++ + M LV+KQRLE + SDL KAEAEVDLLGDEVD LLSLLEKIYIALDHYSPILQH Sbjct: 772 KANVLKTMGLVHKQRLETKSSDLLKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQH 831 Query: 52 YPGVVEILKLIRRELSG 2 YPG++EIL+L+RREL+G Sbjct: 832 YPGIIEILELVRRELTG 848 >ref|XP_006377961.1| hypothetical protein POPTR_0011s16730g [Populus trichocarpa] gi|550328567|gb|ERP55758.1| hypothetical protein POPTR_0011s16730g [Populus trichocarpa] Length = 875 Score = 121 bits (303), Expect = 1e-25 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q L+ KA + RM ++KQ+LE R SDLQKAEAEVDLLGDEV+ LLSLLEKIYIALDH Sbjct: 786 QSGSLIQKAGILTRMGFLHKQKLESRCSDLQKAEAEVDLLGDEVENLLSLLEKIYIALDH 845 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPIL+HY G+ EILKL+RREL+G Sbjct: 846 YSPILKHYSGITEILKLVRRELNG 869 >ref|XP_006293684.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|565471766|ref|XP_006293685.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|482562392|gb|EOA26582.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] gi|482562393|gb|EOA26583.1| hypothetical protein CARUB_v10022643mg [Capsella rubella] Length = 829 Score = 120 bits (302), Expect = 1e-25 Identities = 62/84 (73%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q N++ GKAS YKQRLEK+ DLQKAEAEVDLLGDEV+ LL LLEKIYIALDH Sbjct: 746 QINEVQGKASS-------YKQRLEKKCCDLQKAEAEVDLLGDEVETLLDLLEKIYIALDH 798 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPIL+HYPG++EILKL+RRELSG Sbjct: 799 YSPILKHYPGIIEILKLVRRELSG 822 >ref|XP_006468318.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Citrus sinensis] Length = 936 Score = 120 bits (301), Expect = 2e-25 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q L+ KA++ R L YKQ+LE+R SDLQKAEAEVDLLGDEVD L LLEKIYIALDH Sbjct: 847 QSKGLILKANVITRTGLSYKQKLERRCSDLQKAEAEVDLLGDEVDTLSGLLEKIYIALDH 906 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YS +LQHYPG++EIL+L+RRELSG Sbjct: 907 YSSVLQHYPGIMEILRLVRRELSG 930 >ref|XP_006448888.1| hypothetical protein CICLE_v10014183mg [Citrus clementina] gi|557551499|gb|ESR62128.1| hypothetical protein CICLE_v10014183mg [Citrus clementina] Length = 926 Score = 119 bits (298), Expect = 4e-25 Identities = 59/84 (70%), Positives = 69/84 (82%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q L+ KA++ R L YKQ+LE+R DLQKAEAEVDLLGDEVD L LLEKIYIALDH Sbjct: 837 QSKGLILKANVITRTRLSYKQKLERRCCDLQKAEAEVDLLGDEVDTLSGLLEKIYIALDH 896 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YS +LQHYPG++EIL+L+RRELSG Sbjct: 897 YSSVLQHYPGIMEILRLVRRELSG 920 >ref|XP_007213656.1| hypothetical protein PRUPE_ppa001247mg [Prunus persica] gi|462409521|gb|EMJ14855.1| hypothetical protein PRUPE_ppa001247mg [Prunus persica] Length = 872 Score = 119 bits (297), Expect = 6e-25 Identities = 58/84 (69%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q + L KA++ R +YKQR E++ SDL+KAEAEVDLLGDEV+ LLSL+EKIYIALDH Sbjct: 784 QSHSLKEKANVLVRRGSLYKQRFERKCSDLEKAEAEVDLLGDEVETLLSLVEKIYIALDH 843 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPILQHYPG+ E+LKL+RREL G Sbjct: 844 YSPILQHYPGITEVLKLVRRELRG 867 >ref|NP_181020.2| myosin heavy chain-related [Arabidopsis thaliana] gi|205830840|sp|O64584.2|WAP_ARATH RecName: Full=WPP domain-associated protein gi|330253920|gb|AEC09014.1| myosin heavy chain-related [Arabidopsis thaliana] Length = 825 Score = 119 bits (297), Expect = 6e-25 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q N++ GKAS YKQRLEK+ DL+KAEAEVDLLGDEV+ LL LLEKIYIALDH Sbjct: 742 QINEVKGKAS-------TYKQRLEKKCCDLKKAEAEVDLLGDEVETLLDLLEKIYIALDH 794 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPIL+HYPG++EIL+L+RRELSG Sbjct: 795 YSPILKHYPGIIEILRLVRRELSG 818 >ref|XP_002879512.1| hypothetical protein ARALYDRAFT_482437 [Arabidopsis lyrata subsp. lyrata] gi|297325351|gb|EFH55771.1| hypothetical protein ARALYDRAFT_482437 [Arabidopsis lyrata subsp. lyrata] Length = 834 Score = 119 bits (297), Expect = 6e-25 Identities = 60/84 (71%), Positives = 69/84 (82%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q N++ GKAS YKQRLEK+ DLQKAE EVDLLGDEV+ LL LLEKIYIALDH Sbjct: 751 QINEVKGKAS-------TYKQRLEKKCCDLQKAETEVDLLGDEVETLLDLLEKIYIALDH 803 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPIL+HYPG++EIL+L+RRELSG Sbjct: 804 YSPILKHYPGIIEILRLVRRELSG 827 >ref|XP_004486461.1| PREDICTED: WPP domain-associated protein-like [Cicer arietinum] Length = 857 Score = 118 bits (295), Expect = 1e-24 Identities = 58/80 (72%), Positives = 66/80 (82%) Frame = -3 Query: 241 LVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDHYSPI 62 L KAS + LVYKQR E + SDL KAEAEVDLLGDEVD LL LL KIY+ALDHYSPI Sbjct: 772 LKNKASTLKTTGLVYKQRFETKCSDLAKAEAEVDLLGDEVDTLLRLLGKIYVALDHYSPI 831 Query: 61 LQHYPGVVEILKLIRRELSG 2 LQHYPG++E+L+L+RRELSG Sbjct: 832 LQHYPGIIEVLELVRRELSG 851 >ref|XP_007022891.1| Early endosome antigen, putative isoform 1 [Theobroma cacao] gi|508778257|gb|EOY25513.1| Early endosome antigen, putative isoform 1 [Theobroma cacao] Length = 882 Score = 116 bits (291), Expect = 3e-24 Identities = 58/84 (69%), Positives = 69/84 (82%) Frame = -3 Query: 253 QCNQLVGKASLFRRMELVYKQRLEKRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIALDH 74 Q + L+ A++ +R L YKQ LE+R SDL+KAE EVDLLGD+VD LL LLEKIYIALDH Sbjct: 793 QFSSLIQMANVLKRKGLHYKQNLERRCSDLEKAETEVDLLGDQVDVLLGLLEKIYIALDH 852 Query: 73 YSPILQHYPGVVEILKLIRRELSG 2 YSPIL+HY GV+EIL L+RRELSG Sbjct: 853 YSPILKHYTGVMEILNLVRRELSG 876