BLASTX nr result
ID: Akebia24_contig00037892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037892 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852897.1| hypothetical protein AMTR_s00033p00222240 [A... 71 1e-10 >ref|XP_006852897.1| hypothetical protein AMTR_s00033p00222240 [Amborella trichopoda] gi|548856511|gb|ERN14364.1| hypothetical protein AMTR_s00033p00222240 [Amborella trichopoda] Length = 349 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -1 Query: 324 EMLKKNIPVNATLYEVIIRGLCSSGRLKEAHKYLNEMIENGHLVSYVRWKLIYES 160 EM+ +PVN +LY++IIRGLC G +EAH LNEMIENG+L SY+ W + +S Sbjct: 268 EMINNKVPVNGSLYDIIIRGLCKIGSFQEAHMLLNEMIENGYLASYLGWSSLVDS 322