BLASTX nr result
ID: Akebia24_contig00037825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037825 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39857.3| unnamed protein product [Vitis vinifera] 59 5e-07 emb|CAN74052.1| hypothetical protein VITISV_005345 [Vitis vinifera] 59 5e-07 >emb|CBI39857.3| unnamed protein product [Vitis vinifera] Length = 461 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 113 DRYKCTSCNKSFPSHQALGGHKSSHSKGKN 24 DRY+C++CNKSFP+HQALGGH+SSH+K KN Sbjct: 318 DRYRCSTCNKSFPTHQALGGHRSSHNKFKN 347 >emb|CAN74052.1| hypothetical protein VITISV_005345 [Vitis vinifera] Length = 595 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 113 DRYKCTSCNKSFPSHQALGGHKSSHSKGKN 24 DRY+C++CNKSFP+HQALGGH+SSH+K KN Sbjct: 429 DRYRCSTCNKSFPTHQALGGHRSSHNKFKN 458