BLASTX nr result
ID: Akebia24_contig00037706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037706 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 75 6e-18 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 75.5 bits (184), Expect(2) = 6e-18 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 112 KKGTGPHSPPLGFCFPYLRAHCVCTGEKEVGFTEEEG 2 +KGTGPHSPPLGF FPYLRAHCV TGEKEV FTEEEG Sbjct: 387 EKGTGPHSPPLGFFFPYLRAHCVSTGEKEVDFTEEEG 423 Score = 40.8 bits (94), Expect(2) = 6e-18 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 257 CPSARQYGTSQQLPFLY 207 CPSARQYGTSQQLPFLY Sbjct: 370 CPSARQYGTSQQLPFLY 386