BLASTX nr result
ID: Akebia24_contig00037518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037518 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476974.1| PREDICTED: 26S proteasome non-ATPase regulat... 137 2e-30 ref|XP_006440041.1| hypothetical protein CICLE_v10020559mg [Citr... 137 2e-30 ref|XP_002321676.2| hypothetical protein POPTR_0015s10280g [Popu... 137 2e-30 ref|XP_006374553.1| hypothetical protein POPTR_0015s10280g [Popu... 137 2e-30 ref|XP_007037890.1| 26S proteasome, regulatory subunit Rpn7,Prot... 137 2e-30 ref|XP_007037889.1| 26S proteasome, regulatory subunit Rpn7,Prot... 137 2e-30 ref|XP_003525624.1| PREDICTED: 26S proteasome non-ATPase regulat... 137 2e-30 ref|NP_001242671.1| uncharacterized protein LOC100810692 [Glycin... 137 2e-30 ref|XP_004152512.1| PREDICTED: probable 26S proteasome non-ATPas... 137 2e-30 gb|ADN33965.1| 26S proteasome non-ATPase regulatory subunit [Cuc... 137 2e-30 ref|XP_006366835.1| PREDICTED: 26S proteasome non-ATPase regulat... 136 3e-30 gb|ABK42076.1| 26S proteasome subunit RPN7 [Capsicum annuum] 136 3e-30 ref|XP_006852152.1| hypothetical protein AMTR_s00049p00076930 [A... 136 3e-30 ref|XP_007155515.1| hypothetical protein PHAVU_003G208200g [Phas... 135 4e-30 ref|XP_004242844.1| PREDICTED: probable 26S proteasome non-ATPas... 135 6e-30 ref|XP_002262921.1| PREDICTED: 26S proteasome non-ATPase regulat... 135 6e-30 ref|XP_004157764.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S... 135 8e-30 gb|EYU23158.1| hypothetical protein MIMGU_mgv1a008065mg [Mimulus... 134 1e-29 ref|NP_567709.1| 26S proteasome regulatory subunit Rpn7 [Arabido... 134 1e-29 emb|CAB41122.1| putative proteasome regulatory subunit [Arabidop... 134 1e-29 >ref|XP_006476974.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog [Citrus sinensis] Length = 385 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 198 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 257 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 258 SLYDCQYKSFF 268 >ref|XP_006440041.1| hypothetical protein CICLE_v10020559mg [Citrus clementina] gi|557542303|gb|ESR53281.1| hypothetical protein CICLE_v10020559mg [Citrus clementina] Length = 385 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 198 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 257 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 258 SLYDCQYKSFF 268 >ref|XP_002321676.2| hypothetical protein POPTR_0015s10280g [Populus trichocarpa] gi|550322424|gb|EEF05803.2| hypothetical protein POPTR_0015s10280g [Populus trichocarpa] Length = 451 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 264 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 323 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 324 SLYDCQYKSFF 334 >ref|XP_006374553.1| hypothetical protein POPTR_0015s10280g [Populus trichocarpa] gi|550322423|gb|ERP52350.1| hypothetical protein POPTR_0015s10280g [Populus trichocarpa] Length = 339 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 264 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 323 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 324 SLYDCQYKSFF 334 >ref|XP_007037890.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component (PCI) domain isoform 2 [Theobroma cacao] gi|590669848|ref|XP_007037891.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component (PCI) domain isoform 2 [Theobroma cacao] gi|508775135|gb|EOY22391.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component (PCI) domain isoform 2 [Theobroma cacao] gi|508775136|gb|EOY22392.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component (PCI) domain isoform 2 [Theobroma cacao] Length = 330 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 200 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 259 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 260 SLYDCQYKSFF 270 >ref|XP_007037889.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component (PCI) domain isoform 1 [Theobroma cacao] gi|508775134|gb|EOY22390.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component (PCI) domain isoform 1 [Theobroma cacao] Length = 387 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 200 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 259 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 260 SLYDCQYKSFF 270 >ref|XP_003525624.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog [Glycine max] Length = 386 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|NP_001242671.1| uncharacterized protein LOC100810692 [Glycine max] gi|255644637|gb|ACU22821.1| unknown [Glycine max] Length = 386 Score = 137 bits (345), Expect = 2e-30 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|XP_004152512.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Length = 386 Score = 137 bits (344), Expect = 2e-30 Identities = 66/71 (92%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGK+PYLSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKVPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >gb|ADN33965.1| 26S proteasome non-ATPase regulatory subunit [Cucumis melo subsp. melo] Length = 386 Score = 137 bits (344), Expect = 2e-30 Identities = 66/71 (92%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGK+PYLSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKVPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|XP_006366835.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog [Solanum tuberosum] Length = 386 Score = 136 bits (343), Expect = 3e-30 Identities = 66/71 (92%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SII+LDRVSLKQKVVDAPEILTVIGKIPYLSEF+N Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIITLDRVSLKQKVVDAPEILTVIGKIPYLSEFMN 258 Query: 183 ALYECQYKSFF 215 +LYECQYKSFF Sbjct: 259 SLYECQYKSFF 269 >gb|ABK42076.1| 26S proteasome subunit RPN7 [Capsicum annuum] Length = 386 Score = 136 bits (343), Expect = 3e-30 Identities = 66/71 (92%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SII+LDRVSLKQKVVDAPEILTVIGKIPYLSEF+N Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIITLDRVSLKQKVVDAPEILTVIGKIPYLSEFMN 258 Query: 183 ALYECQYKSFF 215 +LYECQYKSFF Sbjct: 259 SLYECQYKSFF 269 >ref|XP_006852152.1| hypothetical protein AMTR_s00049p00076930 [Amborella trichopoda] gi|548855756|gb|ERN13619.1| hypothetical protein AMTR_s00049p00076930 [Amborella trichopoda] Length = 386 Score = 136 bits (342), Expect = 3e-30 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPE+L VIGKIPYLSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEVLAVIGKIPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LYECQYKSFF Sbjct: 259 SLYECQYKSFF 269 >ref|XP_007155515.1| hypothetical protein PHAVU_003G208200g [Phaseolus vulgaris] gi|561028869|gb|ESW27509.1| hypothetical protein PHAVU_003G208200g [Phaseolus vulgaris] Length = 386 Score = 135 bits (341), Expect = 4e-30 Identities = 66/71 (92%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGKIP+LSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPFLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|XP_004242844.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Solanum lycopersicum] Length = 386 Score = 135 bits (340), Expect = 6e-30 Identities = 65/71 (91%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SII+LDRVSLKQKVVDAPEILTVIGKIPYLSEF+N Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIITLDRVSLKQKVVDAPEILTVIGKIPYLSEFMN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|XP_002262921.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Vitis vinifera] gi|297733617|emb|CBI14864.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 135 bits (340), Expect = 6e-30 Identities = 66/71 (92%), Positives = 69/71 (97%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTVL SIISLDRVSLKQKVVDAPEIL VIGKIPYLSEFLN Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILAVIGKIPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|XP_004157764.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Length = 386 Score = 135 bits (339), Expect = 8e-30 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYE FPY+TFIFYTVL SIISLDRVSLKQKVVDAPEILTVIGK+PYLSEFLN Sbjct: 199 LDSISTFTTYEXFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKVPYLSEFLN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >gb|EYU23158.1| hypothetical protein MIMGU_mgv1a008065mg [Mimulus guttatus] Length = 386 Score = 134 bits (337), Expect = 1e-29 Identities = 64/71 (90%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYELFPY+TFIFYTV+ SIISLDRVSLKQKVVDAPEILTVIGKIPYLS+F+N Sbjct: 199 LDSISTFTTYELFPYDTFIFYTVVTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSDFMN 258 Query: 183 ALYECQYKSFF 215 +LY+CQYKSFF Sbjct: 259 SLYDCQYKSFF 269 >ref|NP_567709.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana] gi|42573029|ref|NP_974611.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana] gi|20978551|sp|Q93Y35.1|PSMD6_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 6 homolog; AltName: Full=26S proteasome regulatory subunit RPN7; Short=AtRPN7; AltName: Full=26S proteasome regulatory subunit S10 homolog gi|15450840|gb|AAK96691.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|20259842|gb|AAM13268.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|21593433|gb|AAM65400.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|23397029|gb|AAN31800.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|32700030|gb|AAP86665.1| 26S proteasome subunit RPN7 [Arabidopsis thaliana] gi|332659566|gb|AEE84966.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana] gi|332659567|gb|AEE84967.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana] Length = 387 Score = 134 bits (337), Expect = 1e-29 Identities = 64/71 (90%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYE+FPYETFIFYTVL SII+LDRVSLKQKVVDAPEILTV+GKIP+LSEFLN Sbjct: 200 LDSISTFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEILTVLGKIPFLSEFLN 259 Query: 183 ALYECQYKSFF 215 +LYECQYK+FF Sbjct: 260 SLYECQYKAFF 270 >emb|CAB41122.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|7269333|emb|CAB79392.1| putative proteasome regulatory subunit [Arabidopsis thaliana] Length = 406 Score = 134 bits (337), Expect = 1e-29 Identities = 64/71 (90%), Positives = 70/71 (98%) Frame = +3 Query: 3 LDSISTFTTYELFPYETFIFYTVLASIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLN 182 LDSISTFTTYE+FPYETFIFYTVL SII+LDRVSLKQKVVDAPEILTV+GKIP+LSEFLN Sbjct: 200 LDSISTFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEILTVLGKIPFLSEFLN 259 Query: 183 ALYECQYKSFF 215 +LYECQYK+FF Sbjct: 260 SLYECQYKAFF 270