BLASTX nr result
ID: Akebia24_contig00037457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037457 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291849.1| PREDICTED: uncharacterized protein LOC101290... 71 1e-10 ref|XP_006847542.1| hypothetical protein AMTR_s00014p00131390 [A... 69 7e-10 ref|XP_006601320.1| PREDICTED: phosphatidylinositol/phosphatidyl... 69 9e-10 ref|XP_006595925.1| PREDICTED: phosphatidylinositol/phosphatidyl... 69 9e-10 ref|XP_003550393.1| PREDICTED: phosphatidylinositol/phosphatidyl... 69 9e-10 ref|XP_003544359.1| PREDICTED: phosphatidylinositol/phosphatidyl... 69 9e-10 ref|XP_002283681.2| PREDICTED: uncharacterized protein LOC100252... 69 9e-10 ref|XP_007222014.1| hypothetical protein PRUPE_ppa002936mg [Prun... 68 2e-09 ref|XP_007160727.1| hypothetical protein PHAVU_001G012100g [Phas... 67 2e-09 ref|XP_006365129.1| PREDICTED: phosphatidylinositol/phosphatidyl... 66 6e-09 ref|XP_006384514.1| hypothetical protein POPTR_0004s16510g [Popu... 66 6e-09 ref|XP_004230868.1| PREDICTED: uncharacterized protein LOC101265... 66 6e-09 ref|XP_004230867.1| PREDICTED: uncharacterized protein LOC101265... 66 6e-09 ref|XP_002306120.1| SEC14 cytosolic factor family protein [Popul... 66 6e-09 ref|XP_006487243.1| PREDICTED: phosphatidylinositol/phosphatidyl... 65 1e-08 ref|XP_006423356.1| hypothetical protein CICLE_v10028023mg [Citr... 65 1e-08 ref|XP_006423355.1| hypothetical protein CICLE_v10028023mg [Citr... 65 1e-08 ref|XP_006423354.1| hypothetical protein CICLE_v10028023mg [Citr... 65 1e-08 ref|XP_007042120.1| Sec14p-like phosphatidylinositol transfer fa... 65 1e-08 ref|XP_007042119.1| Sec14p-like phosphatidylinositol transfer fa... 65 1e-08 >ref|XP_004291849.1| PREDICTED: uncharacterized protein LOC101290835 [Fragaria vesca subsp. vesca] Length = 623 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFSSHEERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 32 >ref|XP_006847542.1| hypothetical protein AMTR_s00014p00131390 [Amborella trichopoda] gi|548850776|gb|ERN09123.1| hypothetical protein AMTR_s00014p00131390 [Amborella trichopoda] Length = 649 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFSSH+E+RERKSDFENS Sbjct: 9 MSGPLDRFARPCFEGFSSHDEKRERKSDFENS 40 >ref|XP_006601320.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X2 [Glycine max] Length = 625 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGHDERRERKSDFENS 32 >ref|XP_006595925.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X2 [Glycine max] Length = 618 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGHDERRERKSDFENS 32 >ref|XP_003550393.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X1 [Glycine max] Length = 624 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGHDERRERKSDFENS 32 >ref|XP_003544359.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X1 [Glycine max] Length = 623 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGHDERRERKSDFENS 32 >ref|XP_002283681.2| PREDICTED: uncharacterized protein LOC100252199 [Vitis vinifera] gi|297744421|emb|CBI37683.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGHDERRERKSDFENS 32 >ref|XP_007222014.1| hypothetical protein PRUPE_ppa002936mg [Prunus persica] gi|462418950|gb|EMJ23213.1| hypothetical protein PRUPE_ppa002936mg [Prunus persica] Length = 620 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFSSH+ER+ERKSD+ENS Sbjct: 1 MSGPLDRFARPCFEGFSSHDERKERKSDYENS 32 >ref|XP_007160727.1| hypothetical protein PHAVU_001G012100g [Phaseolus vulgaris] gi|561034191|gb|ESW32721.1| hypothetical protein PHAVU_001G012100g [Phaseolus vulgaris] Length = 626 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS H+ERRER+SDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGHDERRERRSDFENS 32 >ref|XP_006365129.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Solanum tuberosum] Length = 625 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEG S+H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGSSTHDERRERKSDFENS 32 >ref|XP_006384514.1| hypothetical protein POPTR_0004s16510g [Populus trichocarpa] gi|550341168|gb|ERP62311.1| hypothetical protein POPTR_0004s16510g [Populus trichocarpa] Length = 625 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS ++ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGNDERRERKSDFENS 32 >ref|XP_004230868.1| PREDICTED: uncharacterized protein LOC101265778 isoform 2 [Solanum lycopersicum] Length = 625 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEG S+H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGSSTHDERRERKSDFENS 32 >ref|XP_004230867.1| PREDICTED: uncharacterized protein LOC101265778 isoform 1 [Solanum lycopersicum] Length = 628 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEG S+H+ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGSSTHDERRERKSDFENS 32 >ref|XP_002306120.1| SEC14 cytosolic factor family protein [Populus trichocarpa] gi|222849084|gb|EEE86631.1| SEC14 cytosolic factor family protein [Populus trichocarpa] Length = 636 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS ++ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGNDERRERKSDFENS 32 >ref|XP_006487243.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Citrus sinensis] Length = 623 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS +ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGSDERRERKSDFENS 32 >ref|XP_006423356.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] gi|557525290|gb|ESR36596.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] Length = 483 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS +ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGSDERRERKSDFENS 32 >ref|XP_006423355.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] gi|557525289|gb|ESR36595.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] Length = 624 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS +ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGSDERRERKSDFENS 32 >ref|XP_006423354.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] gi|557525288|gb|ESR36594.1| hypothetical protein CICLE_v10028023mg [Citrus clementina] Length = 623 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS +ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGSDERRERKSDFENS 32 >ref|XP_007042120.1| Sec14p-like phosphatidylinositol transfer family protein isoform 4 [Theobroma cacao] gi|508706055|gb|EOX97951.1| Sec14p-like phosphatidylinositol transfer family protein isoform 4 [Theobroma cacao] Length = 426 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS +ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGSDERRERKSDFENS 32 >ref|XP_007042119.1| Sec14p-like phosphatidylinositol transfer family protein isoform 3 [Theobroma cacao] gi|508706054|gb|EOX97950.1| Sec14p-like phosphatidylinositol transfer family protein isoform 3 [Theobroma cacao] Length = 641 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MSGPLDRFARPCFEGFSSHEERRERKSDFENS 2 MSGPLDRFARPCFEGFS +ERRERKSDFENS Sbjct: 1 MSGPLDRFARPCFEGFSGSDERRERKSDFENS 32