BLASTX nr result
ID: Akebia24_contig00037359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037359 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027782.1| Rho GTPase activating protein with PAK-box/P... 55 8e-06 ref|XP_002530331.1| gtpase activating protein, putative [Ricinus... 55 8e-06 >ref|XP_007027782.1| Rho GTPase activating protein with PAK-box/P21-Rho-binding domain [Theobroma cacao] gi|508716387|gb|EOY08284.1| Rho GTPase activating protein with PAK-box/P21-Rho-binding domain [Theobroma cacao] Length = 485 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/73 (41%), Positives = 46/73 (63%) Frame = +3 Query: 21 QSSVKNCSCEVPNQADILANGPETSINGLKHGKVRANTNKNRTAQSSDSNHRKGTRKVDR 200 +S V NC C V +Q + LANG L+ G +R+ + K+RT QSS S+ +KG++KV+ Sbjct: 400 RSLVDNCPCTVVSQVNSLANG-------LEEGGLRSTSGKSRTGQSSVSSLKKGSKKVNE 452 Query: 201 QPVVCVPGPLDKS 239 + V GP++KS Sbjct: 453 WSICHVAGPVEKS 465 >ref|XP_002530331.1| gtpase activating protein, putative [Ricinus communis] gi|223530135|gb|EEF32047.1| gtpase activating protein, putative [Ricinus communis] Length = 405 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/73 (43%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +3 Query: 24 SSVKNCSCEVPNQADILANGPETSINGLKHGK-VRANTNKNRTAQSSDSNHRKGTRKVDR 200 S V NC CEV +Q L N E G + V+ T KNRT QSS+SN RKG+++V Sbjct: 315 SLVDNCPCEVVSQVSALTN--ENLEGGFTRARGVQLRTCKNRTGQSSNSNSRKGSKRVIE 372 Query: 201 QPVVCVPGPLDKS 239 Q + GP++KS Sbjct: 373 QAIARAAGPVEKS 385