BLASTX nr result
ID: Akebia24_contig00037199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00037199 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276506.1| PREDICTED: putative amidase C869.01-like iso... 55 8e-06 >ref|XP_002276506.1| PREDICTED: putative amidase C869.01-like isoform 1 [Vitis vinifera] Length = 515 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 217 GLQNPYVLSRTPCGSSSGSAITVAANMVMVSL 312 G+QNPYVLS TPCGSSSGSAI+VAAN+ VSL Sbjct: 182 GVQNPYVLSATPCGSSSGSAISVAANLAAVSL 213