BLASTX nr result
ID: Akebia24_contig00036882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00036882 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447444.1| hypothetical protein CICLE_v10018085mg [Citr... 55 8e-06 >ref|XP_006447444.1| hypothetical protein CICLE_v10018085mg [Citrus clementina] gi|568831022|ref|XP_006469780.1| PREDICTED: fasciclin-like arabinogalactan protein 21-like [Citrus sinensis] gi|557550055|gb|ESR60684.1| hypothetical protein CICLE_v10018085mg [Citrus clementina] Length = 353 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 2/74 (2%) Frame = +3 Query: 54 PRIDPKLFQFHVIPQKFSYFELFDLPNGSIFPT-LSGKSLRIT-ISLMDKKVKINSVRVV 227 P + KL Q+H P K S +L P GS PT L K + IT I + ++ ++IN+V V Sbjct: 99 PWLFKKLLQYHTSPLKLSMNDLLMKPQGSCLPTFLHQKKVAITKIVVKERLIEINNVLVS 158 Query: 228 NPDIFVENSITIHG 269 PDIF+E S++IHG Sbjct: 159 RPDIFLEGSLSIHG 172