BLASTX nr result
ID: Akebia24_contig00036879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00036879 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL78659.1|AF405557_1 reverse transcriptase [Fagus sylvatica] 52 3e-09 emb|CAN76289.1| hypothetical protein VITISV_007641 [Vitis vinifera] 40 2e-06 emb|CAN76071.1| hypothetical protein VITISV_004551 [Vitis vinifera] 44 4e-06 >gb|AAL78659.1|AF405557_1 reverse transcriptase [Fagus sylvatica] Length = 168 Score = 52.4 bits (124), Expect(2) = 3e-09 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = +1 Query: 31 IDSVLICNECINARFSLGIPRIICKTDMDKAYEYVN 138 +DSVLI NEC+++R GIP +ICK D++KAY++VN Sbjct: 44 LDSVLIANECLDSRIKSGIPGLICKLDIEKAYDHVN 79 Score = 34.7 bits (78), Expect(2) = 3e-09 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = +2 Query: 221 IVN*NPKGFFRISSEFKQ*DPLSPFLFNIIV 313 IVN +P GFF S +Q DPLSP LF +I+ Sbjct: 112 IVNGSPTGFFDSSRGLRQGDPLSPLLFLVIM 142 >emb|CAN76289.1| hypothetical protein VITISV_007641 [Vitis vinifera] Length = 558 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 14/36 (38%), Positives = 27/36 (75%) Frame = +1 Query: 31 IDSVLICNECINARFSLGIPRIICKTDMDKAYEYVN 138 +D++LI NE +N+R + ++CK D++KAY++V+ Sbjct: 215 LDAILIANEAVNSRLKDNVGGVLCKLDIEKAYDHVS 250 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +2 Query: 221 IVN*NPKGFFRISSEFKQ*DPLSPFLFNIIV 313 ++N +P GFF+ S +Q DPLSP+LF I++ Sbjct: 283 LINDSPSGFFQSSRGLRQGDPLSPYLFVIVI 313 >emb|CAN76071.1| hypothetical protein VITISV_004551 [Vitis vinifera] Length = 1367 Score = 44.3 bits (103), Expect(2) = 4e-06 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = +1 Query: 31 IDSVLICNECINARFSLGIPRIICKTDMDKAYEYVN 138 +D VLI NE +++R G RIICK D++KAY++VN Sbjct: 919 LDVVLIANEALDSRLKSGKGRIICKVDIEKAYDHVN 954 Score = 32.0 bits (71), Expect(2) = 4e-06 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +2 Query: 221 IVN*NPKGFFRISSEFKQ*DPLSPFLFNI 307 ++N +P FF+ S +Q DPLSPFLF I Sbjct: 987 LLNGSPVSFFQSSRGLRQGDPLSPFLFII 1015