BLASTX nr result
ID: Akebia24_contig00036558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00036558 (627 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535172.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 ref|XP_002518258.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 >ref|XP_002535172.1| conserved hypothetical protein [Ricinus communis] gi|223523836|gb|EEF27212.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +1 Query: 73 RRSDGREKEKEQRIYKSNGKRIADTLTAFETLKYNPSGLTPGADPNRK 216 R GREKEKEQRIYKSNG R+ADTLTAF+T KYNPSGLTP P K Sbjct: 21 RERTGREKEKEQRIYKSNGIRMADTLTAFDTKKYNPSGLTPPGGPQPK 68 >ref|XP_002518258.1| conserved hypothetical protein [Ricinus communis] gi|223542605|gb|EEF44144.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 61.2 bits (147), Expect = 2e-07 Identities = 35/61 (57%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +3 Query: 312 FWARQERNSPFDTKG*EQIAGDDLVKGIYERRFSNRVPTE*SAPP--QAY*VQSNSVTSL 485 FWARQERNSPFDTK E IAGDDLVKGIYER R + P +AY + S S+ Sbjct: 124 FWARQERNSPFDTKRQELIAGDDLVKGIYERSAGTRWKRQRREQPNGRAYLKEHQSPPSV 183 Query: 486 R 488 R Sbjct: 184 R 184