BLASTX nr result
ID: Akebia24_contig00036100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00036100 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512902.1| amino acid binding protein, putative [Ricinu... 55 8e-06 >ref|XP_002512902.1| amino acid binding protein, putative [Ricinus communis] gi|223547913|gb|EEF49405.1| amino acid binding protein, putative [Ricinus communis] Length = 443 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 326 KRNLSFSSEPPKETTRSFLFGSLFKARTFQNLRLIRSYS 210 K+NL+ S +P +ETT +L G+LFKARTFQN +LIRSYS Sbjct: 405 KQNLTLSPKPAQETTMGYLLGTLFKARTFQNFKLIRSYS 443