BLASTX nr result
ID: Akebia24_contig00035813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00035813 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266871.1| PREDICTED: pentatricopeptide repeat-containi... 142 6e-32 ref|XP_007050855.1| Pentatricopeptide repeat superfamily protein... 138 7e-31 ref|XP_006480111.1| PREDICTED: pentatricopeptide repeat-containi... 136 3e-30 ref|XP_006444275.1| hypothetical protein CICLE_v10020732mg [Citr... 136 3e-30 ref|XP_007199044.1| hypothetical protein PRUPE_ppa018221mg, part... 130 1e-28 gb|EXB40832.1| hypothetical protein L484_009077 [Morus notabilis] 129 6e-28 gb|EYU46694.1| hypothetical protein MIMGU_mgv1a022667mg, partial... 124 1e-26 ref|XP_004136175.1| PREDICTED: pentatricopeptide repeat-containi... 121 1e-25 ref|XP_004160564.1| PREDICTED: pentatricopeptide repeat-containi... 120 2e-25 ref|XP_004242986.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|XP_004494357.1| PREDICTED: pentatricopeptide repeat-containi... 119 4e-25 ref|XP_006343635.1| PREDICTED: pentatricopeptide repeat-containi... 119 6e-25 ref|XP_004290764.1| PREDICTED: pentatricopeptide repeat-containi... 118 1e-24 ref|XP_003625900.1| Pentatricopeptide repeat-containing protein ... 117 1e-24 ref|XP_006604717.1| PREDICTED: pentatricopeptide repeat-containi... 111 1e-22 ref|XP_002870791.1| pentatricopeptide repeat-containing protein ... 110 2e-22 ref|NP_198751.1| pentatricopeptide repeat-containing protein [Ar... 110 2e-22 ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein... 110 3e-22 ref|XP_003632692.1| PREDICTED: putative pentatricopeptide repeat... 108 6e-22 emb|CBI29893.3| unnamed protein product [Vitis vinifera] 108 6e-22 >ref|XP_002266871.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 468 Score = 142 bits (357), Expect = 6e-32 Identities = 69/90 (76%), Positives = 76/90 (84%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG L+EA +++ MPFEP KVMWGA LAGCR HG+L LSEF AR+LVELEP NGAYYVL Sbjct: 360 RAGILQEAMEVMTRMPFEPNKVMWGAFLAGCRAHGDLELSEFAARKLVELEPGNGAYYVL 419 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSN+YAEMGRWSDVEKVRRLMK L KDL Sbjct: 420 LSNIYAEMGRWSDVEKVRRLMKEGGLTKDL 449 >ref|XP_007050855.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508703116|gb|EOX95012.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 456 Score = 138 bits (348), Expect = 7e-31 Identities = 64/90 (71%), Positives = 76/90 (84%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG+L++AF+ I MPFEPT+ +WG+LLAGCRTHGNL LSEF A++LVELEP N AYYV+ Sbjct: 345 RAGFLDDAFRFIQDMPFEPTRSIWGSLLAGCRTHGNLELSEFAAKKLVELEPANSAYYVV 404 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYA+MGRW D EKVR LMK L+KDL Sbjct: 405 LSNLYADMGRWDDAEKVRALMKERGLKKDL 434 >ref|XP_006480111.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Citrus sinensis] Length = 466 Score = 136 bits (343), Expect = 3e-30 Identities = 64/90 (71%), Positives = 74/90 (82%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAGY+E AFKLI MPFEPTK MWG+LLAGCR + LSEFVA++L+ELEP N AYY++ Sbjct: 362 RAGYIENAFKLINEMPFEPTKTMWGSLLAGCRDQRSFELSEFVAKKLLELEPDNSAYYIM 421 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYAEMGRWSDVE+VR MK L+KDL Sbjct: 422 LSNLYAEMGRWSDVERVRESMKGRGLKKDL 451 >ref|XP_006444275.1| hypothetical protein CICLE_v10020732mg [Citrus clementina] gi|557546537|gb|ESR57515.1| hypothetical protein CICLE_v10020732mg [Citrus clementina] Length = 365 Score = 136 bits (343), Expect = 3e-30 Identities = 64/90 (71%), Positives = 74/90 (82%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAGY+E AFKLI MPFEPTK MWG+LLAGCR + LSEFVA++L+ELEP N AYY++ Sbjct: 261 RAGYIENAFKLINEMPFEPTKTMWGSLLAGCRDQRSFELSEFVAKKLLELEPDNSAYYIM 320 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYAEMGRWSDVE+VR MK L+KDL Sbjct: 321 LSNLYAEMGRWSDVERVRESMKGRGLKKDL 350 >ref|XP_007199044.1| hypothetical protein PRUPE_ppa018221mg, partial [Prunus persica] gi|462394444|gb|EMJ00243.1| hypothetical protein PRUPE_ppa018221mg, partial [Prunus persica] Length = 372 Score = 130 bits (328), Expect = 1e-28 Identities = 61/89 (68%), Positives = 74/89 (83%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R+GYLE+A + MP+EPTK +WG+LLAG +THGNL LSEF AR+LVELEP + AYYVL Sbjct: 264 RSGYLEDALNCLREMPYEPTKAIWGSLLAGGKTHGNLELSEFAARKLVELEPGSSAYYVL 323 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKD 4 LSN+YAEMGRW+DVEKVR +MK L+KD Sbjct: 324 LSNIYAEMGRWNDVEKVRGMMKQRDLKKD 352 >gb|EXB40832.1| hypothetical protein L484_009077 [Morus notabilis] Length = 368 Score = 129 bits (323), Expect = 6e-28 Identities = 62/90 (68%), Positives = 73/90 (81%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG LEEAFK + MP EPTK +WG+LLAG R HGNL LSEF A +L+ELEP N AY+V+ Sbjct: 261 RAGCLEEAFKCVKVMPHEPTKTIWGSLLAGGRAHGNLDLSEFAAWKLIELEPENAAYHVM 320 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSN+YAEMGRW DVEKVR +MK+ L+KDL Sbjct: 321 LSNMYAEMGRWDDVEKVRGMMKDRGLKKDL 350 >gb|EYU46694.1| hypothetical protein MIMGU_mgv1a022667mg, partial [Mimulus guttatus] Length = 454 Score = 124 bits (311), Expect = 1e-26 Identities = 60/90 (66%), Positives = 72/90 (80%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R+ L+EA ++I MPFEPT +WGALLAGCR GN LSE A +LVELEPHN AYYV+ Sbjct: 360 RSKCLDEALRMIEEMPFEPTVSIWGALLAGCRAQGNSELSEIAAWKLVELEPHNCAYYVI 419 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYAE G+WSDVEKVR+LMK+ L+KD+ Sbjct: 420 LSNLYAEKGKWSDVEKVRKLMKDRGLKKDV 449 >ref|XP_004136175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cucumis sativus] Length = 464 Score = 121 bits (303), Expect = 1e-25 Identities = 57/90 (63%), Positives = 70/90 (77%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R G +EEA +I MPFE T+ MWG+LL G R HG+L +SE ARRLVE+EP NG YYV+ Sbjct: 361 RNGCIEEACVMIKDMPFEATRSMWGSLLTGSRAHGSLEVSEIAARRLVEMEPENGGYYVV 420 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSN+YAEMG+WS+VEKVR +MK L+KDL Sbjct: 421 LSNIYAEMGKWSEVEKVREIMKERGLKKDL 450 >ref|XP_004160564.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cucumis sativus] Length = 464 Score = 120 bits (302), Expect = 2e-25 Identities = 56/90 (62%), Positives = 70/90 (77%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R G +EEA +I MPFE T+ MWG+LL G R HG+L +SE AR+LVE+EP NG YYV+ Sbjct: 361 RNGCIEEACVMINDMPFEATRSMWGSLLTGSRAHGSLEVSEIAARKLVEMEPENGGYYVV 420 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSN+YAEMG+WS+VEKVR +MK L+KDL Sbjct: 421 LSNIYAEMGKWSEVEKVREIMKERGLKKDL 450 >ref|XP_004242986.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum lycopersicum] Length = 476 Score = 119 bits (299), Expect = 3e-25 Identities = 55/90 (61%), Positives = 67/90 (74%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R+G+LE+A ++I MP EPTK +WG LLAGCR HGN LSEF A +L+ L P N AYYV+ Sbjct: 369 RSGHLEDALRMITDMPMEPTKSVWGGLLAGCRLHGNQELSEFAAWKLIGLAPRNSAYYVV 428 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 L+NLY MGRW+D EK+R LMK L KDL Sbjct: 429 LANLYGAMGRWNDAEKIRALMKERGLSKDL 458 >ref|XP_004494357.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cicer arietinum] Length = 468 Score = 119 bits (298), Expect = 4e-25 Identities = 58/90 (64%), Positives = 70/90 (77%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG L+EAF+++ MPFE TK MWG+LL G ++ G+L SEF AR+LVELEP N AY+V Sbjct: 361 RAGRLQEAFEVMRCMPFEATKAMWGSLLVGSKSQGDLEFSEFAARKLVELEPDNTAYHVQ 420 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYAE GRWSDVE+VR +MK L KDL Sbjct: 421 LSNLYAEAGRWSDVERVRGMMKERELTKDL 450 >ref|XP_006343635.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Solanum tuberosum] Length = 476 Score = 119 bits (297), Expect = 6e-25 Identities = 55/89 (61%), Positives = 67/89 (75%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R+ +LE+A ++I MP EPTK +WGALLAGCR HGN LSEF A +L+ L P N AYYV+ Sbjct: 369 RSRHLEDALRMITEMPMEPTKSVWGALLAGCRLHGNQELSEFAAWKLIGLAPRNSAYYVV 428 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKD 4 L+NLY EMGRW+D EK+R LMK L KD Sbjct: 429 LANLYGEMGRWNDAEKIRALMKERGLSKD 457 >ref|XP_004290764.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like [Fragaria vesca subsp. vesca] Length = 466 Score = 118 bits (295), Expect = 1e-24 Identities = 59/90 (65%), Positives = 71/90 (78%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG LEEA K + M ++PTK + G+LLA +THG+L LSEF A +LVELEP N AYYVL Sbjct: 358 RAGCLEEAVKCLREMSYQPTKAILGSLLAAGQTHGDLPLSEFAAAKLVELEPGNSAYYVL 417 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYAEMGRW+DVEKVR +MK L+K+L Sbjct: 418 LSNLYAEMGRWNDVEKVRAMMKERDLKKEL 447 >ref|XP_003625900.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500915|gb|AES82118.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 467 Score = 117 bits (294), Expect = 1e-24 Identities = 57/90 (63%), Positives = 68/90 (75%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG L+EAF +I MPFEPT MWG+LL G ++ +L SEF A +LVELEP+N AYYV Sbjct: 360 RAGQLQEAFDIIKCMPFEPTAAMWGSLLLGSKSRDDLEFSEFAATKLVELEPYNTAYYVQ 419 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYAE GRWSDVE++R +MK L KDL Sbjct: 420 LSNLYAEAGRWSDVERIRGMMKERGLTKDL 449 >ref|XP_006604717.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Glycine max] Length = 464 Score = 111 bits (277), Expect = 1e-22 Identities = 54/90 (60%), Positives = 67/90 (74%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 R+G L+EA + +G MPF PTK MWG+LL G + G+L L A +L+ELEP N AYYV Sbjct: 357 RSGRLKEAVEFMGCMPFGPTKAMWGSLLVGSKAQGDLELGLLAAGKLIELEPDNTAYYVH 416 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKDL 1 LSNLYA MGRW+DVEKVR +MK+ +L KDL Sbjct: 417 LSNLYAAMGRWTDVEKVRGVMKDRQLTKDL 446 >ref|XP_002870791.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316627|gb|EFH47050.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 674 Score = 110 bits (276), Expect = 2e-22 Identities = 51/88 (57%), Positives = 65/88 (73%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG L+EA+ LI ++PFEPT +WGALLA C TH N+ L E A +L ELEP N YVL Sbjct: 573 RAGRLDEAYNLITTIPFEPTSTIWGALLAACVTHENVQLGEMAANKLFELEPENTGNYVL 632 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEK 7 L+N+YA +GRW D+EKVR +M+N+ L K Sbjct: 633 LANIYAALGRWKDMEKVRNMMENVGLRK 660 >ref|NP_198751.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171567|sp|Q9FLZ9.1|PP405_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39350 gi|10177683|dbj|BAB11009.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332007040|gb|AED94423.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 677 Score = 110 bits (275), Expect = 2e-22 Identities = 51/88 (57%), Positives = 65/88 (73%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG L+EA+ LI ++PFEPT +WGALLA C TH N+ L E A +L ELEP N YVL Sbjct: 573 RAGRLDEAYNLITTIPFEPTSTVWGALLAACVTHENVQLGEMAANKLFELEPENTGNYVL 632 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEK 7 L+N+YA +GRW D+EKVR +M+N+ L K Sbjct: 633 LANIYAALGRWKDMEKVRSMMENVGLRK 660 >ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508717504|gb|EOY09401.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 718 Score = 110 bits (274), Expect = 3e-22 Identities = 50/89 (56%), Positives = 62/89 (69%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG +EEAF+ I MPFEPT +WG+LL CR H N+ + EFV RRL+E+EP N YV+ Sbjct: 363 RAGRVEEAFEFIKKMPFEPTAALWGSLLGACRVHSNIDIGEFVGRRLLEIEPENAGNYVI 422 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKD 4 LSNL+A GRW DV VR LM ++KD Sbjct: 423 LSNLFASAGRWEDVRMVRDLMMEKAVKKD 451 >ref|XP_003632692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Vitis vinifera] Length = 1053 Score = 108 bits (271), Expect = 6e-22 Identities = 51/89 (57%), Positives = 62/89 (69%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG +EEAF+ I MPFEPT +WG+LL CR H N+ + EFVARRL+E+E N YV+ Sbjct: 830 RAGRVEEAFEFIKKMPFEPTAAIWGSLLGACRVHQNVHIGEFVARRLLEIESENAGNYVI 889 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKD 4 LSNLYA GRW DV VR LMK + K+ Sbjct: 890 LSNLYASAGRWDDVRTVRELMKEKAVIKE 918 >emb|CBI29893.3| unnamed protein product [Vitis vinifera] Length = 784 Score = 108 bits (271), Expect = 6e-22 Identities = 51/89 (57%), Positives = 62/89 (69%) Frame = -1 Query: 270 RAGYLEEAFKLIGSMPFEPTKVMWGALLAGCRTHGNLLLSEFVARRLVELEPHNGAYYVL 91 RAG +EEAF+ I MPFEPT +WG+LL CR H N+ + EFVARRL+E+E N YV+ Sbjct: 363 RAGRVEEAFEFIKKMPFEPTAAIWGSLLGACRVHQNVHIGEFVARRLLEIESENAGNYVI 422 Query: 90 LSNLYAEMGRWSDVEKVRRLMKNMRLEKD 4 LSNLYA GRW DV VR LMK + K+ Sbjct: 423 LSNLYASAGRWDDVRTVRELMKEKAVIKE 451