BLASTX nr result
ID: Akebia24_contig00035768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00035768 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD53814.1| hypothetical protein, partial [Trichoderma harzia... 55 6e-10 >gb|AFD53814.1| hypothetical protein, partial [Trichoderma harzianum] Length = 108 Score = 55.1 bits (131), Expect(2) = 6e-10 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -3 Query: 398 GTKTSHHDLNIVGYRRATYICTKRGKNANMS*PLKQNIKW 279 GTKTSHH LNIVGYRRATY TKR KN N+S K K+ Sbjct: 39 GTKTSHHGLNIVGYRRATYAWTKRCKNVNLSLSQKTGYKF 78 Score = 34.3 bits (77), Expect(2) = 6e-10 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = -1 Query: 283 NGL*SEIRLHEKGITSNRESLYHGGFNL 200 +GL SEIRL+E ITSNRES HG L Sbjct: 79 SGLWSEIRLYESVITSNRESPCHGELTL 106