BLASTX nr result
ID: Akebia24_contig00035711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00035711 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 86 5e-15 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 84 2e-14 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 84 2e-14 gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium h... 83 5e-14 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 83 5e-14 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] 79 5e-13 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 79 5e-13 ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 79 5e-13 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 78 1e-12 ref|YP_004849339.1| ribosomal protein L2 [Cucumis sativus] gi|32... 76 4e-12 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 76 4e-12 gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tubero... 76 4e-12 ref|YP_008802489.1| ribosomal protein L2 (mitochondrion) [Asclep... 76 6e-12 gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] 76 6e-12 gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sa... 70 3e-10 ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|375911... 70 3e-10 ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochond... 70 3e-10 ref|YP_004927575.1| rpl2 (mitochondrion) [Brassica carinata] gi|... 70 3e-10 ref|YP_004927461.1| rpl2 (mitochondrion) [Brassica oleracea] gi|... 70 3e-10 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 69 5e-10 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGAAEHNESKPKTDQGSLPAKPIGEG KDGACKVDRAPV Sbjct: 254 GLVGAAEHNESKPKTDQGSLPAKPIGEGTKDGACKVDRAPV 294 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGAAEHNESKPKTDQGSLPAKPIGEG KDG CKVDRAPV Sbjct: 257 GLVGAAEHNESKPKTDQGSLPAKPIGEGTKDGRCKVDRAPV 297 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVG AEHNESKP+TDQGSLPAKPIGEGPKDGACKV+RAPV Sbjct: 254 GLVGGAEHNESKPETDQGSLPAKPIGEGPKDGACKVNRAPV 294 >gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGAAEHNESKPKTDQGSLPAKPIGE PKD ACKVDRAPV Sbjct: 256 GLVGAAEHNESKPKTDQGSLPAKPIGERPKDRACKVDRAPV 296 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGAAEHNESKPKTDQGSLPAKPIGE PKD ACKVDRAPV Sbjct: 257 GLVGAAEHNESKPKTDQGSLPAKPIGERPKDRACKVDRAPV 297 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] Length = 331 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGA+E NESKPKTDQGSLPAKPIGEG KDG CKVDRAPV Sbjct: 253 GLVGASERNESKPKTDQGSLPAKPIGEGLKDGTCKVDRAPV 293 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGA+E NESKPKTDQGSLPAKPIGEG KDG CKVDRAPV Sbjct: 253 GLVGASERNESKPKTDQGSLPAKPIGEGLKDGTCKVDRAPV 293 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVG AEHNESKP+TD SLPAKPIGEGPKDGACKV+RAPV Sbjct: 254 GLVGGAEHNESKPETDPASLPAKPIGEGPKDGACKVNRAPV 294 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPVV 127 GLVGAAEHNESKPKTDQG +KPIGEGPKDGACKVDRAPVV Sbjct: 257 GLVGAAEHNESKPKTDQGFY-SKPIGEGPKDGACKVDRAPVV 297 >ref|YP_004849339.1| ribosomal protein L2 [Cucumis sativus] gi|325305597|gb|ADZ10766.1| ribosomal protein L2 [Cucumis sativus] Length = 341 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPVV*PVGPKQC 151 GLVG AEH ESK + DQGSLPAKPIGEGPKDGACKV+R PV + +C Sbjct: 263 GLVGGAEHKESKAERDQGSLPAKPIGEGPKDGACKVNRVPVTYLIASHKC 312 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGAAEHNESKPKTDQG +KPIGEGPKDGACKVDRAPV Sbjct: 257 GLVGAAEHNESKPKTDQGFY-SKPIGEGPKDGACKVDRAPV 296 >gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tuberosum] Length = 296 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPVV 127 GLVGA+E NESKPKTDQGSLPAKPIGEG KDG KVDRAPVV Sbjct: 255 GLVGASERNESKPKTDQGSLPAKPIGEGLKDGTRKVDRAPVV 296 >ref|YP_008802489.1| ribosomal protein L2 (mitochondrion) [Asclepias syriaca] gi|556562328|gb|AGZ63024.1| ribosomal protein L2 (mitochondrion) [Asclepias syriaca] Length = 299 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPV 124 GLVGA+EHNESKPK QGSLP KPIGEG KDG CKVDRAPV Sbjct: 238 GLVGASEHNESKPKMYQGSLPTKPIGEGTKDGTCKVDRAPV 278 >gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] Length = 354 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGEGPKDGACKVDRAPVV*PVGPKQC 151 GLVG AEH ESK + DQGSLPAKPIGEGPKDGACKV+R PV + +C Sbjct: 263 GLVGGAEHKESKAERDQGSLPAKPIGEGPKDGACKVNRVPVTYFIASHKC 312 >gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/52 (71%), Positives = 38/52 (73%), Gaps = 11/52 (21%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGE-----------GPKDGACKVDRAPV 124 GLVGAA HN+SKPKTDQGSLPAKPIGE KDGACKVDRAPV Sbjct: 255 GLVGAAGHNKSKPKTDQGSLPAKPIGERAKQLKALRGLRAKDGACKVDRAPV 306 >ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|37591104|dbj|BAC98906.1| ribosomal protein L2 [Brassica napus] Length = 349 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/52 (71%), Positives = 38/52 (73%), Gaps = 11/52 (21%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGE-----------GPKDGACKVDRAPV 124 GLVGAA HN+SKPKTDQGSLPAKPIGE KDGACKVDRAPV Sbjct: 255 GLVGAAGHNKSKPKTDQGSLPAKPIGERAKQLKALRGLRAKDGACKVDRAPV 306 >ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278283|dbj|BAM36207.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278329|dbj|BAM36252.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|443298136|gb|AGC81680.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/52 (71%), Positives = 38/52 (73%), Gaps = 11/52 (21%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGE-----------GPKDGACKVDRAPV 124 GLVGAA HN+SKPKTDQGSLPAKPIGE KDGACKVDRAPV Sbjct: 255 GLVGAAGHNKSKPKTDQGSLPAKPIGERAKQLKALRGLRAKDGACKVDRAPV 306 >ref|YP_004927575.1| rpl2 (mitochondrion) [Brassica carinata] gi|335355036|gb|AEH43590.1| rpl2 [Brassica carinata] Length = 349 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/52 (71%), Positives = 38/52 (73%), Gaps = 11/52 (21%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGE-----------GPKDGACKVDRAPV 124 GLVGAA HN+SKPKTDQGSLPAKPIGE KDGACKVDRAPV Sbjct: 255 GLVGAAGHNKSKPKTDQGSLPAKPIGETAKQLKALRGLRAKDGACKVDRAPV 306 >ref|YP_004927461.1| rpl2 (mitochondrion) [Brassica oleracea] gi|353526706|ref|YP_004927877.1| rpl2 (mitochondrion) [Brassica rapa subsp. oleifera] gi|353531388|ref|YP_004927780.1| rpl2 (mitochondrion) [Brassica juncea] gi|335354894|gb|AEH43450.1| rpl2 [Brassica rapa subsp. oleifera] gi|335354934|gb|AEH43489.1| rpl2 [Brassica oleracea] gi|335355121|gb|AEH43674.1| rpl2 [Brassica juncea] gi|339511323|emb|CBX48378.1| rpl2 [Brassica napus] Length = 349 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/52 (71%), Positives = 38/52 (73%), Gaps = 11/52 (21%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSLPAKPIGE-----------GPKDGACKVDRAPV 124 GLVGAA HN+SKPKTDQGSLPAKPIGE KDGACKVDRAPV Sbjct: 255 GLVGAAGHNKSKPKTDQGSLPAKPIGERAKQLKALRGLRAKDGACKVDRAPV 306 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 69.3 bits (168), Expect = 5e-10 Identities = 41/81 (50%), Positives = 41/81 (50%), Gaps = 39/81 (48%) Frame = +2 Query: 2 GLVGAAEHNESKPKTDQGSL---------------------------------------P 64 GLVGAAEHNESKPK DQGSL P Sbjct: 255 GLVGAAEHNESKPKADQGSLLPRQVLAYALCSGRPSYQNASRSFYKALLPVEASRFGSLP 314 Query: 65 AKPIGEGPKDGACKVDRAPVV 127 AKPIGEGPKDGACKVDRAPVV Sbjct: 315 AKPIGEGPKDGACKVDRAPVV 335