BLASTX nr result
ID: Akebia24_contig00035510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00035510 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phas... 77 2e-12 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 74 2e-11 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 70 2e-10 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 70 4e-10 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 64 2e-08 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-07 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 60 2e-07 ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840... 56 6e-06 >ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] gi|561015106|gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRRS 90 M++FGK++FP QI STTYDVHRSIKNNQTPPS+EQ++AL+D+I S+RRS Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARRS 59 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/58 (60%), Positives = 45/58 (77%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRR 93 M++FGK +FPRQI STTYDVHRSIKNN+TPPS+EQ++ALE++I+S RR Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRR 58 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRS 102 M+LFGK++FPRQI +TTYDVHRSIKNN+ PP++EQ++AL+D+I S Sbjct: 687 MRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 741 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/58 (62%), Positives = 40/58 (68%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRR 93 MK+FGK I RQI +TTYDVHRSIKNN+ PPS EQIQALED+I S RR Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVRR 58 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRR 93 M++ G+++ PRQI +TTYDVHRSIKNN PP++EQ+ AL+DFI S +R Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRKR 58 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRR 93 M+L G+++ PRQI +TTYDVHRSIKNN PP+ EQ+ AL+ FI S +R Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRR 93 M+L GK++ RQ+ +TTYDVHRSIKNN PP++EQ++AL+ +I S +R Sbjct: 1 MRLLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKKR 58 >ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840032 [Brachypodium distachyon] Length = 58 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = -3 Query: 266 MKLFGKYIFPRQIXXXXXXXXXXXSTTYDVHRSIKNNQTPPSKEQIQALEDFIRSSRR 93 M+ K++ PRQ+ TTYDVHRSIKNN P ++EQ++AL+++I S +R Sbjct: 1 MRPLDKHVSPRQVALFAAGLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDSKKR 58