BLASTX nr result
ID: Akebia24_contig00034712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00034712 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007012651.1| Acyl-CoA N-acyltransferases (NAT) superfamil... 55 8e-06 >ref|XP_007012651.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein, putative [Theobroma cacao] gi|508783014|gb|EOY30270.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein, putative [Theobroma cacao] Length = 288 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 289 WTAAWLRAESHWEDRPNERFVLNIRKKNSEE 197 WTAAWLRAESHWEDRP ER+V N ++K +E+ Sbjct: 104 WTAAWLRAESHWEDRPGERYVDNFKRKFAEQ 134