BLASTX nr result
ID: Akebia24_contig00034251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00034251 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22579.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_002266509.1| PREDICTED: protein timeless homolog [Vitis v... 81 1e-13 ref|XP_002513614.1| conserved hypothetical protein [Ricinus comm... 75 9e-12 ref|XP_006374313.1| hypothetical protein POPTR_0015s05970g [Popu... 74 3e-11 ref|XP_006490684.1| PREDICTED: protein timeless homolog [Citrus ... 73 4e-11 ref|XP_006422090.1| hypothetical protein CICLE_v10004177mg [Citr... 73 4e-11 ref|XP_007220878.1| hypothetical protein PRUPE_ppa016593mg [Prun... 71 2e-10 ref|XP_006606156.1| PREDICTED: protein timeless homolog [Glycine... 63 5e-08 ref|XP_007038890.1| Timeless family protein, putative isoform 5,... 62 8e-08 ref|XP_007038889.1| Timeless family protein, putative isoform 4,... 62 8e-08 ref|XP_007038888.1| Timeless family protein, putative isoform 3,... 62 8e-08 ref|XP_007038886.1| Timeless family protein, putative isoform 1 ... 62 8e-08 ref|XP_003592159.1| Topoisomerase 1-associated factor [Medicago ... 62 1e-07 ref|XP_007038887.1| Timeless family protein, putative isoform 2 ... 61 2e-07 ref|XP_004496503.1| PREDICTED: protein timeless homolog isoform ... 60 3e-07 ref|XP_004496502.1| PREDICTED: protein timeless homolog isoform ... 60 3e-07 ref|XP_004496501.1| PREDICTED: protein timeless homolog isoform ... 60 3e-07 ref|XP_004166173.1| PREDICTED: uncharacterized LOC101218315 [Cuc... 60 3e-07 ref|XP_004145911.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 60 3e-07 ref|XP_002865941.1| hypothetical protein ARALYDRAFT_331651 [Arab... 59 7e-07 >emb|CBI22579.3| unnamed protein product [Vitis vinifera] Length = 1217 Score = 81.3 bits (199), Expect = 1e-13 Identities = 43/79 (54%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = -3 Query: 241 ECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTDF 62 ECH I S+SLLHELG+ KKES WG++S G++GS + KG RS+AD+LGED+ D Sbjct: 796 ECHYITSQSLLHELGSLKKESGKWGNIS--RHGEIGSTEGKGWMH-RSIADALGEDEADV 852 Query: 61 VLSRVPIYQKGKDPY-EAE 8 V+S P+YQK D + EAE Sbjct: 853 VISHEPVYQKNDDNFSEAE 871 >ref|XP_002266509.1| PREDICTED: protein timeless homolog [Vitis vinifera] Length = 1269 Score = 81.3 bits (199), Expect = 1e-13 Identities = 43/79 (54%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Frame = -3 Query: 241 ECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTDF 62 ECH I S+SLLHELG+ KKES WG++S G++GS + KG RS+AD+LGED+ D Sbjct: 782 ECHYITSQSLLHELGSLKKESGKWGNIS--RHGEIGSTEGKGWMH-RSIADALGEDEADV 838 Query: 61 VLSRVPIYQKGKDPY-EAE 8 V+S P+YQK D + EAE Sbjct: 839 VISHEPVYQKNDDNFSEAE 857 >ref|XP_002513614.1| conserved hypothetical protein [Ricinus communis] gi|223547522|gb|EEF49017.1| conserved hypothetical protein [Ricinus communis] Length = 1047 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/77 (51%), Positives = 55/77 (71%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 KECH IN+E LLHELG+ KKE+++WG+V +G++GS Q KG RS+AD+LGED+ D Sbjct: 759 KECHYINAEYLLHELGHMKKEAKSWGNVLA--DGELGSSQAKGWVP-RSIADALGEDEAD 815 Query: 64 FVLSRVPIYQKGKDPYE 14 V++ P YQ G + E Sbjct: 816 VVIAHEP-YQNGGNAME 831 >ref|XP_006374313.1| hypothetical protein POPTR_0015s05970g [Populus trichocarpa] gi|550322072|gb|ERP52110.1| hypothetical protein POPTR_0015s05970g [Populus trichocarpa] Length = 1341 Score = 73.6 bits (179), Expect = 3e-11 Identities = 41/79 (51%), Positives = 50/79 (63%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 KECH IN+E +LHELG+ KKES WG+ S D+GS Q K R RS+AD+LGED+ D Sbjct: 853 KECHYINAEYMLHELGHLKKESAGWGNASANK--DIGSSQGK-RWAPRSIADALGEDEAD 909 Query: 64 FVLSRVPIYQKGKDPYEAE 8 V+ YQ G D E E Sbjct: 910 VVIPHELGYQNGGDAAEHE 928 >ref|XP_006490684.1| PREDICTED: protein timeless homolog [Citrus sinensis] Length = 1139 Score = 73.2 bits (178), Expect = 4e-11 Identities = 40/64 (62%), Positives = 48/64 (75%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELGN KK+S WG+VS GD GSLQ KG A RS+AD+LGED+ D Sbjct: 688 RECHYINAEYLLHELGNAKKQSGAWGNVS--EIGDTGSLQAKGWAR-RSIADALGEDEAD 744 Query: 64 FVLS 53 V+S Sbjct: 745 VVIS 748 >ref|XP_006422090.1| hypothetical protein CICLE_v10004177mg [Citrus clementina] gi|557523963|gb|ESR35330.1| hypothetical protein CICLE_v10004177mg [Citrus clementina] Length = 1200 Score = 73.2 bits (178), Expect = 4e-11 Identities = 40/64 (62%), Positives = 48/64 (75%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELGN KK+S WG+VS GD GSLQ KG A RS+AD+LGED+ D Sbjct: 788 RECHYINAEYLLHELGNAKKQSGAWGNVS--EIGDTGSLQAKGWAR-RSIADALGEDEAD 844 Query: 64 FVLS 53 V+S Sbjct: 845 VVIS 848 >ref|XP_007220878.1| hypothetical protein PRUPE_ppa016593mg [Prunus persica] gi|462417340|gb|EMJ22077.1| hypothetical protein PRUPE_ppa016593mg [Prunus persica] Length = 1204 Score = 70.9 bits (172), Expect = 2e-10 Identities = 40/81 (49%), Positives = 51/81 (62%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 KECH IN+E LLHELG+ KKESRNW + G E +G +KG RS+AD+LGED+ D Sbjct: 789 KECHYINAEYLLHELGHLKKESRNWANSLGDEE--IGHSLDKGWTS-RSIADALGEDEAD 845 Query: 64 FVLSRVPIYQKGKDPYEAELQ 2 VLS ++ G E E + Sbjct: 846 VVLSHELGHENGAQAIENETE 866 >ref|XP_006606156.1| PREDICTED: protein timeless homolog [Glycine max] Length = 1254 Score = 62.8 bits (151), Expect = 5e-08 Identities = 36/73 (49%), Positives = 46/73 (63%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LL ELG+ KKES NW + G E +GS K RS+AD+LGED+ D Sbjct: 782 RECHYINAEYLLSELGHLKKESANWNNTQGDEE--IGSSPAKVWTR-RSIADALGEDEAD 838 Query: 64 FVLSRVPIYQKGK 26 V++ YQK K Sbjct: 839 VVITHDSGYQKDK 851 >ref|XP_007038890.1| Timeless family protein, putative isoform 5, partial [Theobroma cacao] gi|508776135|gb|EOY23391.1| Timeless family protein, putative isoform 5, partial [Theobroma cacao] Length = 1095 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/77 (44%), Positives = 48/77 (62%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELG+WKK S+ S G++GS + G RS+AD+LGED+ D Sbjct: 781 RECHYINAEYLLHELGHWKKGSKTQDSAP--RNGEIGSSEASEWVG-RSIADALGEDEAD 837 Query: 64 FVLSRVPIYQKGKDPYE 14 V+S + G++ E Sbjct: 838 VVISHERGHLNGENSME 854 >ref|XP_007038889.1| Timeless family protein, putative isoform 4, partial [Theobroma cacao] gi|508776134|gb|EOY23390.1| Timeless family protein, putative isoform 4, partial [Theobroma cacao] Length = 1098 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/77 (44%), Positives = 48/77 (62%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELG+WKK S+ S G++GS + G RS+AD+LGED+ D Sbjct: 781 RECHYINAEYLLHELGHWKKGSKTQDSAP--RNGEIGSSEASEWVG-RSIADALGEDEAD 837 Query: 64 FVLSRVPIYQKGKDPYE 14 V+S + G++ E Sbjct: 838 VVISHERGHLNGENSME 854 >ref|XP_007038888.1| Timeless family protein, putative isoform 3, partial [Theobroma cacao] gi|508776133|gb|EOY23389.1| Timeless family protein, putative isoform 3, partial [Theobroma cacao] Length = 1095 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/77 (44%), Positives = 48/77 (62%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELG+WKK S+ S G++GS + G RS+AD+LGED+ D Sbjct: 781 RECHYINAEYLLHELGHWKKGSKTQDSAP--RNGEIGSSEASEWVG-RSIADALGEDEAD 837 Query: 64 FVLSRVPIYQKGKDPYE 14 V+S + G++ E Sbjct: 838 VVISHERGHLNGENSME 854 >ref|XP_007038886.1| Timeless family protein, putative isoform 1 [Theobroma cacao] gi|508776131|gb|EOY23387.1| Timeless family protein, putative isoform 1 [Theobroma cacao] Length = 1128 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/77 (44%), Positives = 48/77 (62%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELG+WKK S+ S G++GS + G RS+AD+LGED+ D Sbjct: 781 RECHYINAEYLLHELGHWKKGSKTQDSAP--RNGEIGSSEASEWVG-RSIADALGEDEAD 837 Query: 64 FVLSRVPIYQKGKDPYE 14 V+S + G++ E Sbjct: 838 VVISHERGHLNGENSME 854 >ref|XP_003592159.1| Topoisomerase 1-associated factor [Medicago truncatula] gi|355481207|gb|AES62410.1| Topoisomerase 1-associated factor [Medicago truncatula] Length = 1335 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/70 (47%), Positives = 45/70 (64%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LL ELG+ K E++NW G +G++GS K RSLAD+LG+D+ D Sbjct: 830 RECHYINAEYLLDELGHLKNETKNWNDTQG--DGEIGSSPGKPWTR-RSLADALGDDEAD 886 Query: 64 FVLSRVPIYQ 35 V+S YQ Sbjct: 887 VVISHDSRYQ 896 >ref|XP_007038887.1| Timeless family protein, putative isoform 2 [Theobroma cacao] gi|508776132|gb|EOY23388.1| Timeless family protein, putative isoform 2 [Theobroma cacao] Length = 1134 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/64 (50%), Positives = 43/64 (67%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E LLHELG+WKK S+ S G++GS + G RS+AD+LGED+ D Sbjct: 781 RECHYINAEYLLHELGHWKKGSKTQDSAP--RNGEIGSSEASEWVG-RSIADALGEDEAD 837 Query: 64 FVLS 53 V+S Sbjct: 838 VVIS 841 >ref|XP_004496503.1| PREDICTED: protein timeless homolog isoform X3 [Cicer arietinum] Length = 1370 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E +L ELG+ KKES+NW G +G++GS K RS+AD+LG+D+ D Sbjct: 831 RECHYINAEYMLGELGHLKKESKNWNDTQG--DGEIGSSPMKPWTR-RSIADALGDDEAD 887 Query: 64 FVLS 53 V+S Sbjct: 888 VVIS 891 >ref|XP_004496502.1| PREDICTED: protein timeless homolog isoform X2 [Cicer arietinum] Length = 1384 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E +L ELG+ KKES+NW G +G++GS K RS+AD+LG+D+ D Sbjct: 809 RECHYINAEYMLGELGHLKKESKNWNDTQG--DGEIGSSPMKPWTR-RSIADALGDDEAD 865 Query: 64 FVLS 53 V+S Sbjct: 866 VVIS 869 >ref|XP_004496501.1| PREDICTED: protein timeless homolog isoform X1 [Cicer arietinum] Length = 1406 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 +ECH IN+E +L ELG+ KKES+NW G +G++GS K RS+AD+LG+D+ D Sbjct: 831 RECHYINAEYMLGELGHLKKESKNWNDTQG--DGEIGSSPMKPWTR-RSIADALGDDEAD 887 Query: 64 FVLS 53 V+S Sbjct: 888 VVIS 891 >ref|XP_004166173.1| PREDICTED: uncharacterized LOC101218315 [Cucumis sativus] Length = 1190 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/64 (54%), Positives = 45/64 (70%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 KECH I++E L+HELG WKKESR + +GG+E GSL K RS+AD+LGED+ D Sbjct: 773 KECHYIDAEYLVHELGCWKKESRE-ENFTGGDEN--GSLTGKHWTP-RSIADALGEDEAD 828 Query: 64 FVLS 53 VL+ Sbjct: 829 VVLT 832 >ref|XP_004145911.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101218315 [Cucumis sativus] Length = 1197 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/64 (54%), Positives = 45/64 (70%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 KECH I++E L+HELG WKKESR + +GG+E GSL K RS+AD+LGED+ D Sbjct: 780 KECHYIDAEYLVHELGCWKKESRE-ENFTGGDEN--GSLTGKHWTP-RSIADALGEDEAD 835 Query: 64 FVLS 53 VL+ Sbjct: 836 VVLT 839 >ref|XP_002865941.1| hypothetical protein ARALYDRAFT_331651 [Arabidopsis lyrata subsp. lyrata] gi|297311776|gb|EFH42200.1| hypothetical protein ARALYDRAFT_331651 [Arabidopsis lyrata subsp. lyrata] Length = 1145 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/74 (47%), Positives = 46/74 (62%) Frame = -3 Query: 244 KECHNINSESLLHELGNWKKESRNWGSVSGGNEGDMGSLQNKGRAGIRSLADSLGEDDTD 65 KECH IN+E +LHELG+ +K+ N VSG E G+ KG A RSLAD+LG+D+ D Sbjct: 761 KECHYINAEYMLHELGHLRKQMGNQEKVSGTEE--YGTSSEKGWAR-RSLADALGDDEAD 817 Query: 64 FVLSRVPIYQKGKD 23 V+S +Q D Sbjct: 818 VVISYDQGFQNEDD 831