BLASTX nr result
ID: Akebia24_contig00034196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00034196 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] 80 3e-13 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 77 2e-12 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 76 4e-12 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 75 7e-12 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 75 1e-11 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 74 3e-11 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 73 5e-11 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 73 5e-11 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 70 2e-10 ref|XP_003628521.1| Metallothionein-like protein [Medicago trunc... 70 4e-10 gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] 69 5e-10 emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] 69 5e-10 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 69 7e-10 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 69 9e-10 dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] 68 2e-09 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 68 2e-09 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 68 2e-09 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 68 2e-09 sp|O24059.1|MT3_MALDO RecName: Full=Metallothionein-like protein... 67 2e-09 >emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] Length = 65 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/47 (78%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVI-DAPASEND 157 MSSCGNCDCADKT C KKGN YG DIIETQKSYD VV+ D A+END Sbjct: 1 MSSCGNCDCADKTNCPKKGNSYGFDIIETQKSYDDVVVMDVQAAEND 47 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +2 Query: 26 SCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVIDAPASEND 157 +CGNCDCADKTQCVKKG+ Y DIIET+KS TVV+DAPA+END Sbjct: 4 TCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAEND 47 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/47 (68%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 MS+CGNCDCADK+QCVKKGN YG+DI+ET+KSY TVV++ PA++++ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHE 47 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 MS+CGNCDC DK+QCVKKGN YG+DI+ET+KSY D V++ A A+E+D Sbjct: 1 MSTCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAEHD 47 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVIDAPAS 148 MS+CGNCDCADK+QCVKKGN YG++IIET+KSY V++APA+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVVEAPAA 43 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVIDAPAS 148 MS+CGNCDCADK+QCVKKGN YG++IIET+KS VIDAPA+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDAPAA 43 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVIDAPASEND 157 MS+CGNCDCADK+QCVKKGN YG++IIET+KSY V + A++N+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAAKNE 46 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKS-YDTVVIDAPASEND 157 MS+CGNCDCADK+QCVKKGNGY ++IIET+KS Y V + PA+E+D Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAEHD 47 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/46 (63%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 S+CGNCDCADK+QCVKKG+ Y DI+ET+KS+ T+++D PA+E+D Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHD 48 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVIDAPAS 148 MS+CGNCDCADK+QCVKKGN YG++IIET+KS VIDA A+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDASAA 43 >ref|XP_003628521.1| Metallothionein-like protein [Medicago truncatula] gi|355522543|gb|AET02997.1| Metallothionein-like protein [Medicago truncatula] gi|388521467|gb|AFK48795.1| unknown [Medicago truncatula] Length = 63 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/46 (71%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 SSCGNCDCADK+QC KGN YG+ I+ETQKS+ +TVV+DAPA E+D Sbjct: 3 SSCGNCDCADKSQC-GKGNNYGMTIVETQKSFVETVVMDAPAVEHD 47 >gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] Length = 63 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 MS+CG+CDCADK+QCVKKGNGYG+ IIET+KSY + VV A A+E D Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAEPD 47 >emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] Length = 63 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 MS+CG+CDCADK+QCVKKGNGYG+ IIET+KSY + VV A A+E D Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAEPD 47 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/46 (65%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 S+CGNCDCADK+QCVKKG+ Y DI+ET+KS+ TVV++ PA+E D Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPATEPD 48 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/47 (65%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPA-SEND 157 S+CGNCDCADK+QCVKKG+ Y DI+ET+KS+ T+V+D PA +END Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 20 MSSCGNCDCADKTQCVKKGNGYGLDIIETQKSYDTVVI 133 MSSCGNCDCADKTQCVKKG Y LDI+ETQ+SY +I Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTLDIVETQESYKEAMI 38 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/46 (60%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQK-SYDTVVIDAPASEND 157 S+CGNCDCADK+QCVKKG+ Y D++ET+K S T+V++ PA+E+D Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAAEHD 48 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/46 (65%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQKSY-DTVVIDAPASEND 157 S+C NCDCADKTQCVKKG+ Y DI+ET+KS+ T V++ PA+END Sbjct: 3 STCDNCDCADKTQCVKKGSSYTADIVETEKSHVSTGVMEVPATEND 48 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/46 (67%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 23 SSCGNCDCADKTQCVKKGNGYGLDIIETQK-SYDTVVIDAPASEND 157 ++CGNCDCADKTQCV KGN YG+DI+ET+K +TVV++ PA END Sbjct: 3 NTCGNCDCADKTQCV-KGNKYGVDIVETEKRMVETVVMEVPAGEND 47 >sp|O24059.1|MT3_MALDO RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1655853|gb|AAC23698.1| metallothionein-like protein [Malus domestica] gi|126723806|gb|ABO26817.1| metallothionein-like protein [Malus domestica] gi|339269305|gb|AEJ37039.1| type 3 metallothionein [Malus domestica] gi|456496763|gb|AGG38010.1| metallothionein type 3 [Malus domestica] Length = 66 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +2 Query: 29 CGNCDCADKTQCVKKGNGYGLDIIETQ-KSYDTVVIDAPASEND 157 C NCDCAD TQCVKKGN Y L I+ET+ +S DTV +DAPA+E+D Sbjct: 5 CDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFVDAPAAEHD 48