BLASTX nr result
ID: Akebia24_contig00034042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00034042 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC98906.1| hypothetical protein BAUCODRAFT_64861 [Baudoinia ... 108 1e-21 ref|XP_007583014.1| putative 60s ribosomal protein l43 protein [... 106 3e-21 gb|EME84721.1| hypothetical protein MYCFIDRAFT_88568 [Pseudocerc... 106 3e-21 gb|EME45253.1| hypothetical protein DOTSEDRAFT_71080 [Dothistrom... 106 3e-21 gb|EKG12109.1| Ribosomal protein L37ae [Macrophomina phaseolina ... 106 3e-21 gb|EMF13193.1| 60S ribosomal protein L37a [Sphaerulina musiva SO... 104 1e-20 gb|EHK97114.1| putative 60S ribosomal protein L43 [Glarea lozoye... 103 2e-20 ref|XP_007291236.1| 60S ribosomal protein L37a [Marssonina brunn... 103 3e-20 gb|EXJ66530.1| ribosomal protein L37ae [Cladophialophora psammop... 101 9e-20 ref|XP_001402255.1| 60S ribosomal protein L43 [Aspergillus niger... 101 9e-20 gb|EXJ86269.1| 60S ribosomal protein L43 [Capronia coronata CBS ... 101 1e-19 ref|XP_756025.1| 60S ribosomal protein L37a [Aspergillus fumigat... 101 1e-19 gb|EKV16040.1| 60S ribosomal protein L37a [Penicillium digitatum... 101 1e-19 ref|XP_002568944.1| Pc21g19530 [Penicillium chrysogenum Wisconsi... 101 1e-19 ref|XP_001261157.1| 60S ribosomal protein L43 [Neosartorya fisch... 101 1e-19 ref|XP_001275968.1| 60S ribosomal protein L43 [Aspergillus clava... 101 1e-19 ref|XP_001209368.1| 60S ribosomal protein L43 [Aspergillus terre... 101 1e-19 gb|ETS75711.1| 60S ribosomal protein L43 [Pestalotiopsis fici W1... 100 2e-19 gb|ESZ89578.1| 60S ribosomal protein L37a [Sclerotinia borealis ... 100 2e-19 ref|XP_001935731.1| 60S ribosomal protein L43 [Pyrenophora triti... 100 2e-19 >gb|EMC98906.1| hypothetical protein BAUCODRAFT_64861 [Baudoinia compniacensis UAMH 10762] Length = 92 Score = 108 bits (269), Expect = 1e-21 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKVTVKR S GIWNC+SCGKT+AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKVTVKRHSTGIWNCRSCGKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_007583014.1| putative 60s ribosomal protein l43 protein [Neofusicoccum parvum UCRNP2] gi|485924791|gb|EOD49521.1| putative 60s ribosomal protein l43 protein [Neofusicoccum parvum UCRNP2] Length = 92 Score = 106 bits (265), Expect = 3e-21 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKVTVKR SVGIWNC+SC KT+AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKVTVKRHSVGIWNCRSCKKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EME84721.1| hypothetical protein MYCFIDRAFT_88568 [Pseudocercospora fijiensis CIRAD86] Length = 92 Score = 106 bits (265), Expect = 3e-21 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKVTVKR++ GIWNC++CGKT+AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKVTVKRQATGIWNCRACGKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EME45253.1| hypothetical protein DOTSEDRAFT_71080 [Dothistroma septosporum NZE10] Length = 92 Score = 106 bits (265), Expect = 3e-21 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKV+VKR +VGIW+CKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKVSVKRNAVGIWDCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EKG12109.1| Ribosomal protein L37ae [Macrophomina phaseolina MS6] Length = 92 Score = 106 bits (265), Expect = 3e-21 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKVTVKR SVGIWNC+SC KT+AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKVTVKRHSVGIWNCRSCKKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EMF13193.1| 60S ribosomal protein L37a [Sphaerulina musiva SO2202] Length = 92 Score = 104 bits (260), Expect = 1e-20 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKV+VKR +VGIW+C+SCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKVSVKRVAVGIWDCRSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EHK97114.1| putative 60S ribosomal protein L43 [Glarea lozoyensis 74030] gi|512199976|gb|EPE28809.1| Zn-binding ribosomal protein [Glarea lozoyensis ATCC 20868] Length = 92 Score = 103 bits (257), Expect = 2e-20 Identities = 49/54 (90%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR SVGIWNCKSC KTVAGGAYTVSTPAAAA RST+RRLREIAEV Sbjct: 39 CTFCGKTTVKRHSVGIWNCKSCKKTVAGGAYTVSTPAAAAMRSTLRRLREIAEV 92 >ref|XP_007291236.1| 60S ribosomal protein L37a [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865312|gb|EKD18354.1| 60S ribosomal protein L37a [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 138 Score = 103 bits (256), Expect = 3e-20 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR SVGIWNCK+C KTVAGGAYTVSTPAAAA RST+RRLREIAEV Sbjct: 85 CTFCGKTTVKRHSVGIWNCKACNKTVAGGAYTVSTPAAAAMRSTLRRLREIAEV 138 >gb|EXJ66530.1| ribosomal protein L37ae [Cladophialophora psammophila CBS 110553] Length = 92 Score = 101 bits (252), Expect = 9e-20 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIWNCK C KTVAGGA+TVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRQAVGIWNCKGCKKTVAGGAWTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001402255.1| 60S ribosomal protein L43 [Aspergillus niger CBS 513.88] gi|134074873|emb|CAK38984.1| unnamed protein product [Aspergillus niger] gi|350631906|gb|EHA20275.1| hypothetical protein ASPNIDRAFT_57444 [Aspergillus niger ATCC 1015] gi|358374403|dbj|GAA90995.1| 60S ribosomal protein L43 [Aspergillus kawachii IFO 4308] Length = 92 Score = 101 bits (252), Expect = 9e-20 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRKAVGIWECKGCNKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EXJ86269.1| 60S ribosomal protein L43 [Capronia coronata CBS 617.96] Length = 92 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR SVGIW CK C KT+AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRHSVGIWTCKGCKKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_756025.1| 60S ribosomal protein L37a [Aspergillus fumigatus Af293] gi|66853663|gb|EAL93987.1| 60S ribosomal protein L37a [Aspergillus fumigatus Af293] gi|159130078|gb|EDP55192.1| 60S ribosomal protein L37a [Aspergillus fumigatus A1163] Length = 92 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRQAVGIWECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EKV16040.1| 60S ribosomal protein L37a [Penicillium digitatum Pd1] gi|425780012|gb|EKV18035.1| 60S ribosomal protein L37a [Penicillium digitatum PHI26] Length = 92 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRKAVGIWECKGCDKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_002568944.1| Pc21g19530 [Penicillium chrysogenum Wisconsin 54-1255] gi|211590655|emb|CAP96850.1| Pc21g19530 [Penicillium chrysogenum Wisconsin 54-1255] Length = 92 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRKAVGIWECKGCDKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001261157.1| 60S ribosomal protein L43 [Neosartorya fischeri NRRL 181] gi|119409311|gb|EAW19260.1| 60S ribosomal protein L37a [Neosartorya fischeri NRRL 181] Length = 89 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 36 CTFCGKNTVKRQAVGIWECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 89 >ref|XP_001275968.1| 60S ribosomal protein L43 [Aspergillus clavatus NRRL 1] gi|119404125|gb|EAW14542.1| 60S ribosomal protein L37a [Aspergillus clavatus NRRL 1] Length = 92 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRQAVGIWECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001209368.1| 60S ribosomal protein L43 [Aspergillus terreus NIH2624] gi|238502447|ref|XP_002382457.1| 60S ribosomal protein L43 [Aspergillus flavus NRRL3357] gi|317147898|ref|XP_003190126.1| 60S ribosomal protein L43 [Aspergillus oryzae RIB40] gi|114187815|gb|EAU29515.1| 60S ribosomal protein L43 [Aspergillus terreus NIH2624] gi|220691267|gb|EED47615.1| 60S ribosomal protein L37a [Aspergillus flavus NRRL3357] Length = 92 Score = 101 bits (251), Expect = 1e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR++VGIW CK C KTVAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CTFCGKNTVKRQAVGIWECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|ETS75711.1| 60S ribosomal protein L43 [Pestalotiopsis fici W106-1] Length = 92 Score = 100 bits (249), Expect = 2e-19 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGKV VKR SVGIWNC+SC KTVAGGAYTVSTPAA A RST+RRLREIAEV Sbjct: 39 CTFCGKVNVKRHSVGIWNCRSCRKTVAGGAYTVSTPAAVAMRSTLRRLREIAEV 92 >gb|ESZ89578.1| 60S ribosomal protein L37a [Sclerotinia borealis F-4157] Length = 92 Score = 100 bits (249), Expect = 2e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 CTFCGK TVKR SVGIW+CKSC KTVAGGAYTV+TPAAAA RST+RRLREIAEV Sbjct: 39 CTFCGKTTVKRHSVGIWDCKSCKKTVAGGAYTVTTPAAAAMRSTLRRLREIAEV 92 >ref|XP_001935731.1| 60S ribosomal protein L43 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330906022|ref|XP_003295325.1| 60S ribosomal protein L43 [Pyrenophora teres f. teres 0-1] gi|187982830|gb|EDU48318.1| 60S ribosomal protein L37a [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311333483|gb|EFQ96582.1| hypothetical protein PTT_00414 [Pyrenophora teres f. teres 0-1] Length = 92 Score = 100 bits (249), Expect = 2e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +3 Query: 3 CTFCGKVTVKRESVGIWNCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 164 C+FCGK TVKR +VGIW+CKSCGK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 39 CSFCGKNTVKRRAVGIWDCKSCGKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 92