BLASTX nr result
ID: Akebia24_contig00034038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00034038 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26927.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002280374.1| PREDICTED: uncharacterized protein LOC100249... 59 5e-07 gb|EXB65612.1| Uncharacterized transporter [Morus notabilis] 59 7e-07 ref|XP_002526597.1| auxin:hydrogen symporter, putative [Ricinus ... 59 7e-07 ref|XP_002312429.2| auxin efflux carrier family protein [Populus... 58 1e-06 ref|XP_006448301.1| hypothetical protein CICLE_v10015208mg [Citr... 57 3e-06 ref|XP_007045070.1| Auxin efflux carrier family protein [Theobro... 55 8e-06 >emb|CBI26927.3| unnamed protein product [Vitis vinifera] Length = 406 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 287 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 E+L SAVVPLLKLLSLTVIGLVLAHPKTQ++PR+ Sbjct: 6 EDLVSAVVPLLKLLSLTVIGLVLAHPKTQMIPRS 39 >ref|XP_002280374.1| PREDICTED: uncharacterized protein LOC100249273 [Vitis vinifera] Length = 436 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 287 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 E+L SAVVPLLKLLSLTVIGLVLAHPKTQ++PR+ Sbjct: 6 EDLVSAVVPLLKLLSLTVIGLVLAHPKTQMIPRS 39 >gb|EXB65612.1| Uncharacterized transporter [Morus notabilis] Length = 452 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = +2 Query: 287 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 E+L+SA++PLLKLL+LTVIGLVLAHPKTQI+P+A Sbjct: 19 EDLKSAILPLLKLLALTVIGLVLAHPKTQIIPKA 52 >ref|XP_002526597.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223534037|gb|EEF35756.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 451 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 11/51 (21%) Frame = +2 Query: 269 MSGFLE-----------ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 MSGFL ENL +A+VPL+KLLSLTVIGLVL HPKTQI P+A Sbjct: 1 MSGFLSALPGNNLKSSGENLATAIVPLMKLLSLTVIGLVLGHPKTQITPKA 51 >ref|XP_002312429.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550332927|gb|EEE89796.2| auxin efflux carrier family protein [Populus trichocarpa] Length = 449 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 287 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 ENL +A+VPL+KLLSLTVIGLVLAHPK Q++PRA Sbjct: 18 ENLLTAIVPLMKLLSLTVIGLVLAHPKAQMIPRA 51 >ref|XP_006448301.1| hypothetical protein CICLE_v10015208mg [Citrus clementina] gi|568829001|ref|XP_006468822.1| PREDICTED: uncharacterized protein LOC102628002 [Citrus sinensis] gi|557550912|gb|ESR61541.1| hypothetical protein CICLE_v10015208mg [Citrus clementina] Length = 452 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = +2 Query: 284 EENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 E+N+ SA++PLLKLLSLTVIGL+LAHP+ Q++PRA Sbjct: 17 EQNVLSAILPLLKLLSLTVIGLILAHPRQQMIPRA 51 >ref|XP_007045070.1| Auxin efflux carrier family protein [Theobroma cacao] gi|508709005|gb|EOY00902.1| Auxin efflux carrier family protein [Theobroma cacao] Length = 450 Score = 55.5 bits (132), Expect = 8e-06 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = +2 Query: 242 ISKNIKERKMSGFLEENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRA 388 I+KN K SG E+L SAV PL+KLLSLTVIGLVLAHPKTQI+PRA Sbjct: 8 IAKN--NMKSSG---EDLLSAV-PLMKLLSLTVIGLVLAHPKTQIIPRA 50