BLASTX nr result
ID: Akebia24_contig00032887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00032887 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845523.1| hypothetical protein AMTR_s00019p00168020 [A... 65 1e-08 >ref|XP_006845523.1| hypothetical protein AMTR_s00019p00168020 [Amborella trichopoda] gi|548848095|gb|ERN07198.1| hypothetical protein AMTR_s00019p00168020 [Amborella trichopoda] Length = 266 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/51 (54%), Positives = 42/51 (82%), Gaps = 3/51 (5%) Frame = -2 Query: 145 RSWSRIKEDQIISLVKQCKDA---RKLKRVHAHLVVNGQSQNNFLITKLVR 2 R WSR++ED+++ L++ C R+LK++HA+L+VNGQSQNNFL+TKL+R Sbjct: 2 RRWSRLEEDRLVELIRLCGGGHCQRQLKQIHAYLLVNGQSQNNFLLTKLIR 52