BLASTX nr result
ID: Akebia24_contig00032871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00032871 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu] 38 2e-06 >gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu] Length = 1140 Score = 38.1 bits (87), Expect(3) = 2e-06 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 101 EET*WWKDKVQKVIREKKDLLQVRQMTRNG*NLEK 205 ++T WW D VQK I+EKKD + + R+ N+EK Sbjct: 412 KDTWWWNDDVQKAIKEKKDCFRRLYLDRSADNIEK 446 Score = 33.1 bits (74), Expect(3) = 2e-06 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 262 YDDLYERFGTTSD-K*LYNIEYIGERKTEDLDYVNCTK 372 Y+DLY+R T D + +Y + I RK D+D V C K Sbjct: 466 YEDLYQRLDTKEDERDIYKMAKIRVRKARDVDQVKCIK 503 Score = 24.6 bits (52), Expect(3) = 2e-06 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 387 LVKYEEIKKRWWVYFLK*LN 446 LVK +EIK RW YF K N Sbjct: 510 LVKDKEIKHRWREYFEKLFN 529