BLASTX nr result
ID: Akebia24_contig00029980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029980 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844609.1| hypothetical protein AMTR_s00016p00218760 [A... 60 4e-07 ref|XP_007225511.1| hypothetical protein PRUPE_ppa000293mg [Prun... 56 5e-06 ref|XP_004140647.1| PREDICTED: uncharacterized protein LOC101204... 56 5e-06 >ref|XP_006844609.1| hypothetical protein AMTR_s00016p00218760 [Amborella trichopoda] gi|548847080|gb|ERN06284.1| hypothetical protein AMTR_s00016p00218760 [Amborella trichopoda] Length = 1663 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +1 Query: 235 EGEVDFPKDLPFLKVLDEQLTTKDQFTSENNIPLSPQWLHAKPSESK 375 EG+ D P DL +K DE KDQ EN+IPLSPQWLHAKPSESK Sbjct: 3 EGKFDLPDDLILMKSPDEYF--KDQLAFENSIPLSPQWLHAKPSESK 47 >ref|XP_007225511.1| hypothetical protein PRUPE_ppa000293mg [Prunus persica] gi|462422447|gb|EMJ26710.1| hypothetical protein PRUPE_ppa000293mg [Prunus persica] Length = 1334 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 7/54 (12%) Frame = +1 Query: 235 EGEVDFPKDLPFLKVLDEQLTTKDQF-------TSENNIPLSPQWLHAKPSESK 375 EG++D P DL K D+ T+KDQ SE++IPLSPQWL+AKPSESK Sbjct: 3 EGKLDLPDDLLLSKPSDQSWTSKDQIKEFAYPAASESSIPLSPQWLYAKPSESK 56 >ref|XP_004140647.1| PREDICTED: uncharacterized protein LOC101204211 [Cucumis sativus] Length = 1599 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +1 Query: 235 EGEVDFPKDLPFLKVLDEQLTTKDQFTSENNIPLSPQWLHAKPSESK 375 +G+ D P DL + D T KD SEN+IPLSPQWL+AKPSE+K Sbjct: 3 DGKFDLPDDLLSSRPSDHSWTPKDSVASENSIPLSPQWLYAKPSETK 49