BLASTX nr result
ID: Akebia24_contig00029777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029777 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535064.1| conserved hypothetical protein [Ricinus comm... 82 8e-14 ref|XP_002529669.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 >ref|XP_002535064.1| conserved hypothetical protein [Ricinus communis] gi|223524116|gb|EEF27325.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 59 WIACQLCFQRPIKTKQLFMYGNPSTQKTLILHFLAKVLRIYFPSARRN 202 WIACQ+ QRPIKTKQLF+YG PSTQKTLI+ FLAKV+RIYF S+RRN Sbjct: 180 WIACQVIHQRPIKTKQLFIYGPPSTQKTLIIGFLAKVMRIYFASSRRN 227 >ref|XP_002529669.1| conserved hypothetical protein [Ricinus communis] gi|223530849|gb|EEF32711.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = +2 Query: 62 IACQLCFQRPIKTKQLFMYGNPSTQKTLILHFLAKVLRIYFPSARRN 202 IACQ+ +QRPIKTKQLF+YG P+TQKTLI+ FLAKV+RIYF S+RRN Sbjct: 100 IACQVIYQRPIKTKQLFIYGPPNTQKTLIIGFLAKVMRIYFASSRRN 146