BLASTX nr result
ID: Akebia24_contig00029379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029379 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310599.2| hypothetical protein POPTR_0007s06460g [Popu... 61 1e-07 ref|XP_002307124.2| hypothetical protein POPTR_0005s08500g [Popu... 61 2e-07 ref|NP_001233866.1| somatic embryogenesis receptor kinase 1 [Sol... 61 2e-07 gb|ABR18800.1| somatic embryogenesis receptor-like kinase 1 [Sol... 61 2e-07 ref|NP_001275293.1| somatic embryogenesis receptor-like kinase 1... 61 2e-07 gb|ABO14173.1| somatic embryogenesis receptor-like kinase 1 [Sol... 61 2e-07 gb|EYU35664.1| hypothetical protein MIMGU_mgv1a013556mg [Mimulus... 60 2e-07 ref|XP_004160232.1| PREDICTED: somatic embryogenesis receptor ki... 60 2e-07 ref|XP_004138361.1| PREDICTED: somatic embryogenesis receptor ki... 60 2e-07 emb|CBI32849.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor ki... 60 2e-07 gb|AAR83872.1| induced stolon tip protein LRP [Capsicum annuum] 60 2e-07 ref|XP_004249343.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass... 60 3e-07 ref|XP_006339232.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass... 60 3e-07 emb|CAJ77502.1| putative somatic embryogenesis receptor kinase l... 60 3e-07 ref|XP_006390738.1| hypothetical protein EUTSA_v10019435mg, part... 60 4e-07 pdb|4LSX|C Chain C, Plant Steroid Receptor Ectodomain Bound To B... 60 4e-07 pdb|4LSC|A Chain A, Isolated Serk1 Co-receptor Ectodomain At Hig... 60 4e-07 ref|XP_004972726.1| PREDICTED: somatic embryogenesis receptor ki... 60 4e-07 ref|XP_007020220.1| Somatic embryogenesis receptor-like kinase 2... 60 4e-07 >ref|XP_002310599.2| hypothetical protein POPTR_0007s06460g [Populus trichocarpa] gi|550334268|gb|EEE91049.2| hypothetical protein POPTR_0007s06460g [Populus trichocarpa] Length = 598 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LRI+L DPNNVLQSWDP LVNPCTWFH Sbjct: 33 DALHNLRINLQDPNNVLQSWDPTLVNPCTWFH 64 >ref|XP_002307124.2| hypothetical protein POPTR_0005s08500g [Populus trichocarpa] gi|550338406|gb|EEE94120.2| hypothetical protein POPTR_0005s08500g [Populus trichocarpa] Length = 627 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 33 DALRNLRVNLQDPNNVLQSWDPTLVNPCTWFH 64 >ref|NP_001233866.1| somatic embryogenesis receptor kinase 1 [Solanum lycopersicum] gi|321146038|gb|ADW65657.1| somatic embryogenesis receptor kinase 1 [Solanum lycopersicum] gi|321146040|gb|ADW65658.1| somatic embryogenesis receptor kinase 1 [Solanum lycopersicum] Length = 629 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 35 DALHSLRVNLQDPNNVLQSWDPTLVNPCTWFH 66 >gb|ABR18800.1| somatic embryogenesis receptor-like kinase 1 [Solanum peruvianum] Length = 629 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 35 DALHSLRVNLQDPNNVLQSWDPTLVNPCTWFH 66 >ref|NP_001275293.1| somatic embryogenesis receptor-like kinase 1 [Solanum tuberosum] gi|126466786|gb|ABO14172.1| somatic embryogenesis receptor-like kinase 1 [Solanum tuberosum] Length = 629 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 35 DALHSLRVNLQDPNNVLQSWDPTLVNPCTWFH 66 >gb|ABO14173.1| somatic embryogenesis receptor-like kinase 1 [Solanum tuberosum] Length = 629 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 35 DALHSLRVNLQDPNNVLQSWDPTLVNPCTWFH 66 >gb|EYU35664.1| hypothetical protein MIMGU_mgv1a013556mg [Mimulus guttatus] Length = 217 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP+NVLQSWDPNLVNPCTWFH Sbjct: 36 LRRSLSDPDNVLQSWDPNLVNPCTWFH 62 >ref|XP_004160232.1| PREDICTED: somatic embryogenesis receptor kinase 1-like, partial [Cucumis sativus] Length = 148 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR SL DPNNVLQSWDP LVNPCTWFH Sbjct: 33 DALHSLRTSLQDPNNVLQSWDPTLVNPCTWFH 64 >ref|XP_004138361.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cucumis sativus] Length = 627 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR SL DPNNVLQSWDP LVNPCTWFH Sbjct: 33 DALHSLRTSLQDPNNVLQSWDPTLVNPCTWFH 64 >emb|CBI32849.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP+NVLQSWDPNLVNPCTWFH Sbjct: 121 LRRSLSDPDNVLQSWDPNLVNPCTWFH 147 >ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Vitis vinifera] Length = 218 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP+NVLQSWDPNLVNPCTWFH Sbjct: 37 LRRSLSDPDNVLQSWDPNLVNPCTWFH 63 >gb|AAR83872.1| induced stolon tip protein LRP [Capsicum annuum] Length = 101 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP+NVLQSWDPNLVNPCTWFH Sbjct: 40 LRRSLSDPDNVLQSWDPNLVNPCTWFH 66 >ref|XP_004249343.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like [Solanum lycopersicum] gi|1619300|emb|CAA64565.1| LRR protein [Solanum lycopersicum] Length = 221 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP NVLQSWDPNLVNPCTWFH Sbjct: 40 LRRSLSDPGNVLQSWDPNLVNPCTWFH 66 >ref|XP_006339232.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1-like [Solanum tuberosum] Length = 221 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP NVLQSWDPNLVNPCTWFH Sbjct: 40 LRRSLSDPGNVLQSWDPNLVNPCTWFH 66 >emb|CAJ77502.1| putative somatic embryogenesis receptor kinase leucine-rich repeat protein 2 precursor [Solanum tuberosum] Length = 69 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 82 LRISLSDPNNVLQSWDPNLVNPCTWFH 2 LR SLSDP NVLQSWDPNLVNPCTWFH Sbjct: 40 LRRSLSDPGNVLQSWDPNLVNPCTWFH 66 >ref|XP_006390738.1| hypothetical protein EUTSA_v10019435mg, partial [Eutrema salsugineum] gi|557087172|gb|ESQ28024.1| hypothetical protein EUTSA_v10019435mg, partial [Eutrema salsugineum] Length = 603 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 9 DALHTLRVTLVDPNNVLQSWDPTLVNPCTWFH 40 >pdb|4LSX|C Chain C, Plant Steroid Receptor Ectodomain Bound To Brassinolide And Serk1 Co- Receptor Ectodomain gi|538261335|pdb|4LSX|D Chain D, Plant Steroid Receptor Ectodomain Bound To Brassinolide And Serk1 Co- Receptor Ectodomain Length = 203 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 12 DALHTLRVTLVDPNNVLQSWDPTLVNPCTWFH 43 >pdb|4LSC|A Chain A, Isolated Serk1 Co-receptor Ectodomain At High Resolution Length = 223 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR++L DPNNVLQSWDP LVNPCTWFH Sbjct: 13 DALHTLRVTLVDPNNVLQSWDPTLVNPCTWFH 44 >ref|XP_004972726.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Setaria italica] Length = 631 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR +L+DPNNVLQSWDP LVNPCTWFH Sbjct: 37 DALHSLRTNLNDPNNVLQSWDPTLVNPCTWFH 68 >ref|XP_007020220.1| Somatic embryogenesis receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508725548|gb|EOY17445.1| Somatic embryogenesis receptor-like kinase 2 isoform 1 [Theobroma cacao] Length = 628 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 97 EEIEKLRISLSDPNNVLQSWDPNLVNPCTWFH 2 + + LR +L+DPNNVLQSWDP LVNPCTWFH Sbjct: 34 DALHSLRTNLNDPNNVLQSWDPTLVNPCTWFH 65