BLASTX nr result
ID: Akebia24_contig00029160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029160 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520663.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_007050821.1| Mitochondrial transcription termination fact... 75 1e-11 ref|XP_002520664.1| conserved hypothetical protein [Ricinus comm... 75 1e-11 ref|XP_002321027.2| hypothetical protein POPTR_0014s12770g [Popu... 74 2e-11 ref|XP_002269635.2| PREDICTED: uncharacterized protein LOC100251... 72 1e-10 emb|CAN68941.1| hypothetical protein VITISV_028996 [Vitis vinifera] 72 1e-10 ref|NP_568185.1| mitochondrial transcription termination factor ... 71 1e-10 ref|XP_006289922.1| hypothetical protein CARUB_v10003538mg [Caps... 71 1e-10 ref|XP_002269678.2| PREDICTED: uncharacterized protein LOC100245... 71 1e-10 emb|CBI32246.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002269551.1| PREDICTED: uncharacterized protein LOC100261... 71 1e-10 ref|XP_006397978.1| hypothetical protein EUTSA_v10001776mg, part... 70 2e-10 emb|CAN68940.1| hypothetical protein VITISV_028995 [Vitis vinifera] 70 2e-10 ref|XP_002271799.2| PREDICTED: uncharacterized protein LOC100246... 70 3e-10 ref|XP_003632359.1| PREDICTED: uncharacterized protein LOC100266... 69 7e-10 ref|XP_002269711.1| PREDICTED: uncharacterized protein LOC100240... 69 9e-10 ref|XP_002871294.1| mitochondrial transcription termination fact... 68 1e-09 ref|XP_004296649.1| PREDICTED: uncharacterized protein LOC101295... 67 3e-09 ref|XP_004296648.1| PREDICTED: uncharacterized protein LOC101295... 67 3e-09 ref|XP_002526726.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 >ref|XP_002520663.1| conserved hypothetical protein [Ricinus communis] gi|223540048|gb|EEF41625.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/65 (50%), Positives = 50/65 (76%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF+ +G S +L + L+ DP+++TRS+ NQI+P+ NFLKS + +N+ I++ LKR Sbjct: 105 LLPKLEFFYSIGVSSSDLARTLSSDPTLLTRSIENQIVPSYNFLKSILLSNEKIVSALKR 164 Query: 32 TTWGF 18 TTW F Sbjct: 165 TTWIF 169 >ref|XP_007050821.1| Mitochondrial transcription termination factor family protein [Theobroma cacao] gi|508703082|gb|EOX94978.1| Mitochondrial transcription termination factor family protein [Theobroma cacao] Length = 402 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/65 (52%), Positives = 49/65 (75%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +G S +L + L+ DP+++TRSL NQIIP+ +FLKS + +N+ I++ LKR Sbjct: 131 LLPKLEFFQSIGLSSCDLARTLSSDPTLLTRSLENQIIPSYDFLKSVLLSNEKIVSALKR 190 Query: 32 TTWGF 18 TTW F Sbjct: 191 TTWIF 195 >ref|XP_002520664.1| conserved hypothetical protein [Ricinus communis] gi|223540049|gb|EEF41626.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/65 (52%), Positives = 49/65 (75%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF+ +G S L + L+ DP+++TRSL NQIIP+ NFLKS + +++ I++ LKR Sbjct: 130 LLPKLEFFYSIGASNSALARALSSDPTLLTRSLENQIIPSYNFLKSILLSDEKIVSALKR 189 Query: 32 TTWGF 18 TTW F Sbjct: 190 TTWIF 194 >ref|XP_002321027.2| hypothetical protein POPTR_0014s12770g [Populus trichocarpa] gi|550324082|gb|EEE99342.2| hypothetical protein POPTR_0014s12770g [Populus trichocarpa] Length = 400 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/65 (49%), Positives = 49/65 (75%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK++FF LG S P+L + L+ DP+++TRSL NQI+P+ NFLK+ + +++ I++ KR Sbjct: 129 LLPKLDFFLSLGMSRPHLARTLSSDPTLLTRSLENQIVPSYNFLKTILRSDEKIVSAFKR 188 Query: 32 TTWGF 18 TTW F Sbjct: 189 TTWIF 193 >ref|XP_002269635.2| PREDICTED: uncharacterized protein LOC100251083, partial [Vitis vinifera] Length = 375 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++A P I+ RSL N +IP+ NFLKS + N+NI+ L + Sbjct: 116 LLPKLEFFRSVGFSGPDLASIVAASPQILRRSLENHVIPSYNFLKSVVMVNENIVRALNK 175 Query: 32 TTW 24 + W Sbjct: 176 SYW 178 >emb|CAN68941.1| hypothetical protein VITISV_028996 [Vitis vinifera] Length = 2634 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++A P I+ RSL N +IP+ NFLKS + N+NI+ L + Sbjct: 970 LLPKLEFFRSVGFSGPDLASIVAASPQILRRSLENHVIPSYNFLKSVVMVNENIVRALNK 1029 Query: 32 TTW 24 + W Sbjct: 1030 SYW 1032 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++ P I+ RSL N +IP+ NFLKS + N+NI+ K+ Sbjct: 597 LLPKLEFFRSVGFSGPDLASIVVSSPIILRRSLENHVIPSYNFLKSVVMVNENIVRAFKK 656 Query: 32 TTW 24 T W Sbjct: 657 TFW 659 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/63 (52%), Positives = 42/63 (66%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++ PSI+ RSL N +IP NFLKS N+NI L+R Sbjct: 1863 LLPKLEFFRSVGFSGPDLAGIIVAKPSILKRSLENHVIPNYNFLKSVGMINENIARALRR 1922 Query: 32 TTW 24 T W Sbjct: 1923 TYW 1925 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/63 (47%), Positives = 43/63 (68%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++A P I+ RSL N +IP+ NFLKS + N+ I+ L + Sbjct: 2352 LLPKLEFFRSVGFSGPDLASIVAASPQILRRSLENHVIPSYNFLKSVVIVNEKIVRALSK 2411 Query: 32 TTW 24 + W Sbjct: 2412 SYW 2414 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF GFSGP+LV+++ PSI+ RSL N +IP+ NFLKS ++NI+ R Sbjct: 116 LLPKLEFFXSAGFSGPDLVRIVVGSPSILKRSLENHLIPSYNFLKSMDMVHENIVKAFSR 175 Query: 32 TTW 24 + W Sbjct: 176 SYW 178 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/63 (46%), Positives = 42/63 (66%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSG +L ++ P I+ RSL N +IP+ NFLKS + N+NI+ L + Sbjct: 1332 LLPKLEFFCSVGFSGXDLASIVVAGPQILKRSLENHVIPSYNFLKSVLMVNENIVRALNK 1391 Query: 32 TTW 24 + W Sbjct: 1392 SYW 1394 >ref|NP_568185.1| mitochondrial transcription termination factor family protein [Arabidopsis thaliana] gi|13878065|gb|AAK44110.1|AF370295_1 unknown protein [Arabidopsis thaliana] gi|6562304|emb|CAB62602.1| putative protein [Arabidopsis thaliana] gi|10176724|dbj|BAB09954.1| unnamed protein product [Arabidopsis thaliana] gi|17104655|gb|AAL34216.1| unknown protein [Arabidopsis thaliana] gi|21592327|gb|AAM64278.1| unknown [Arabidopsis thaliana] gi|332003836|gb|AED91219.1| mitochondrial transcription termination factor family protein [Arabidopsis thaliana] Length = 405 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/65 (52%), Positives = 47/65 (72%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+ FF +G S L + LA DP+I+TRSL NQ+IP+ NFLKS + +++ I+A L+R Sbjct: 137 LLPKLSFFLSIGVSKSLLARTLASDPTILTRSLVNQLIPSYNFLKSVLDSDEKIVAALRR 196 Query: 32 TTWGF 18 TTW F Sbjct: 197 TTWVF 201 >ref|XP_006289922.1| hypothetical protein CARUB_v10003538mg [Capsella rubella] gi|482558628|gb|EOA22820.1| hypothetical protein CARUB_v10003538mg [Capsella rubella] Length = 407 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/65 (52%), Positives = 47/65 (72%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+ FF +G S L + LA DP+I+TRSL NQ+IP+ NFLKS + +++ I+A L+R Sbjct: 139 LLPKLSFFLSIGVSKSLLARTLASDPTILTRSLVNQLIPSYNFLKSVLDSDEKIVAALRR 198 Query: 32 TTWGF 18 TTW F Sbjct: 199 TTWVF 203 >ref|XP_002269678.2| PREDICTED: uncharacterized protein LOC100245941 [Vitis vinifera] Length = 352 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++ P I+ RSL N +IP+ NFLKS + N+NI+ K+ Sbjct: 97 LLPKLEFFRSVGFSGPDLASIVVSSPIILRRSLENHVIPSYNFLKSVVMVNENIVRAFKK 156 Query: 32 TTW 24 T W Sbjct: 157 TFW 159 >emb|CBI32246.3| unnamed protein product [Vitis vinifera] Length = 408 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/63 (52%), Positives = 42/63 (66%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++ PSI+ RSL N +IP NFLKS N+NI L+R Sbjct: 116 LLPKLEFFRSVGFSGPDLAGIIVAKPSILKRSLENHVIPNYNFLKSVGMINENIARALRR 175 Query: 32 TTW 24 T W Sbjct: 176 TYW 178 >ref|XP_002269551.1| PREDICTED: uncharacterized protein LOC100261332 [Vitis vinifera] Length = 462 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/63 (52%), Positives = 42/63 (66%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++ PSI+ RSL N +IP NFLKS N+NI L+R Sbjct: 116 LLPKLEFFRSVGFSGPDLAGIIVAKPSILKRSLENHVIPNYNFLKSVGMINENIARALRR 175 Query: 32 TTW 24 T W Sbjct: 176 TYW 178 >ref|XP_006397978.1| hypothetical protein EUTSA_v10001776mg, partial [Eutrema salsugineum] gi|557099051|gb|ESQ39431.1| hypothetical protein EUTSA_v10001776mg, partial [Eutrema salsugineum] Length = 362 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/65 (52%), Positives = 46/65 (70%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+ FF +G S L + LA DP+I+TRSL NQ+IP+ NFLKS + ++ I+A L+R Sbjct: 94 LLPKLRFFLSIGVSKSLLARTLASDPTILTRSLANQLIPSYNFLKSVLDSDTKIVAALRR 153 Query: 32 TTWGF 18 TTW F Sbjct: 154 TTWVF 158 >emb|CAN68940.1| hypothetical protein VITISV_028995 [Vitis vinifera] Length = 379 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/63 (47%), Positives = 45/63 (71%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP++ +L+ +P I+ R L N +IPT FLKS + N+N++ VL++ Sbjct: 97 LLPKLEFFRSVGFSGPDIAGILSSNPYILKRGLQNNLIPTYTFLKSVVMVNENVVRVLRK 156 Query: 32 TTW 24 T W Sbjct: 157 THW 159 >ref|XP_002271799.2| PREDICTED: uncharacterized protein LOC100246295 [Vitis vinifera] Length = 387 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/63 (50%), Positives = 45/63 (71%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSG +L +L+ PSI++RSL N +IP NFLKS +N++ + VLKR Sbjct: 114 LLPKLEFFRSIGFSGAHLASILSSKPSILSRSLENNLIPKYNFLKSVHISNEDAMKVLKR 173 Query: 32 TTW 24 + W Sbjct: 174 SCW 176 >ref|XP_003632359.1| PREDICTED: uncharacterized protein LOC100266539 [Vitis vinifera] Length = 398 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/63 (47%), Positives = 43/63 (68%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF +GFSGP+L ++A P I+ RSL N +IP+ NFLKS + N+ I+ L + Sbjct: 116 LLPKLEFFRSVGFSGPDLASIVAASPQILRRSLENHVIPSYNFLKSVVIVNEKIVRALSK 175 Query: 32 TTW 24 + W Sbjct: 176 SYW 178 >ref|XP_002269711.1| PREDICTED: uncharacterized protein LOC100240848 [Vitis vinifera] Length = 502 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+EFF GFSGP+LV+++ PSI+ RSL N +IP+ NFLKS ++NI+ R Sbjct: 151 LLPKLEFFSSAGFSGPDLVRIVVGSPSILKRSLENHLIPSYNFLKSMDMVHENIVKAFSR 210 Query: 32 TTW 24 + W Sbjct: 211 SYW 213 >ref|XP_002871294.1| mitochondrial transcription termination factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297317131|gb|EFH47553.1| mitochondrial transcription termination factor family protein [Arabidopsis lyrata subsp. lyrata] Length = 404 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PK+ FF +G S L + LA DP+I+TRSL NQ+IP+ FLKS + +++ I+A L+R Sbjct: 136 LLPKLLFFLSIGVSKSLLARTLASDPTILTRSLVNQLIPSYKFLKSVLDSDEKIVAALRR 195 Query: 32 TTWGF 18 TTW F Sbjct: 196 TTWVF 200 >ref|XP_004296649.1| PREDICTED: uncharacterized protein LOC101295216 isoform 2 [Fragaria vesca subsp. vesca] Length = 387 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/65 (46%), Positives = 48/65 (73%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PKIEFF +G S +L ++L ++P +++RSL NQI+P+ N L+S + + +N++AVLKR Sbjct: 120 LAPKIEFFSSVGLSRVDLARVLTFNPQLLSRSLENQIVPSYNLLRSLI-SEENVVAVLKR 178 Query: 32 TTWGF 18 +W F Sbjct: 179 RSWLF 183 >ref|XP_004296648.1| PREDICTED: uncharacterized protein LOC101295216 isoform 1 [Fragaria vesca subsp. vesca] Length = 391 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/65 (46%), Positives = 48/65 (73%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PKIEFF +G S +L ++L ++P +++RSL NQI+P+ N L+S + + +N++AVLKR Sbjct: 120 LAPKIEFFSSVGLSRVDLARVLTFNPQLLSRSLENQIVPSYNLLRSLI-SEENVVAVLKR 178 Query: 32 TTWGF 18 +W F Sbjct: 179 RSWLF 183 >ref|XP_002526726.1| conserved hypothetical protein [Ricinus communis] gi|223533915|gb|EEF35640.1| conserved hypothetical protein [Ricinus communis] Length = 272 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/60 (45%), Positives = 44/60 (73%) Frame = -1 Query: 212 LQPKIEFFHDLGFSGPNLVKLLAYDPSIITRSLHNQIIPTLNFLKSFMGTNDNILAVLKR 33 L PKI+FFH GFSGP++ K+L+ P I+ S+ NQ+IP +NF+++ + +ND ++ +KR Sbjct: 121 LLPKIQFFHSKGFSGPDIAKILSACPEILHTSIENQLIPAVNFIQNLLPSNDKVVYAIKR 180