BLASTX nr result
ID: Akebia24_contig00029140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029140 (664 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350965.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_004959556.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_004250455.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 tpg|DAA61963.1| TPA: hypothetical protein ZEAMMB73_954210 [Zea m... 100 3e-19 ref|NP_001145953.1| uncharacterized protein LOC100279479 [Zea ma... 100 3e-19 gb|EMT26564.1| hypothetical protein F775_03208 [Aegilops tauschii] 100 4e-19 ref|XP_004295338.1| PREDICTED: pentatricopeptide repeat-containi... 100 5e-19 emb|CAJ26357.1| Selenium binding protein [Brachypodium sylvaticum] 100 5e-19 emb|CAJ19324.1| selenium binding protein [Triticum aestivum] 100 7e-19 gb|EXB64625.1| hypothetical protein L484_017957 [Morus notabilis] 99 9e-19 ref|XP_002308737.1| pentatricopeptide repeat-containing family p... 99 9e-19 ref|XP_006467236.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_006449977.1| hypothetical protein CICLE_v100176692mg, par... 99 1e-18 gb|EEE51036.1| hypothetical protein OsJ_31684 [Oryza sativa Japo... 99 2e-18 emb|CBI18780.3| unnamed protein product [Vitis vinifera] 99 2e-18 gb|EEC67055.1| hypothetical protein OsI_33800 [Oryza sativa Indi... 99 2e-18 ref|XP_007026426.1| Tetratricopeptide repeat-like superfamily pr... 98 2e-18 dbj|BAJ96548.1| predicted protein [Hordeum vulgare subsp. vulgare] 98 3e-18 ref|XP_002460419.1| hypothetical protein SORBIDRAFT_02g027830 [S... 98 3e-18 ref|XP_006447804.1| hypothetical protein CICLE_v10017893mg [Citr... 97 5e-18 >ref|XP_006350965.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Solanum tuberosum] Length = 654 Score = 100 bits (250), Expect = 3e-19 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCH+AFKFVSKV++REII+RDTNRFHHF +GSCSCGDYW Sbjct: 606 RIKKNIRVCGDCHTAFKFVSKVVDREIILRDTNRFHHFRNGSCSCGDYW 654 >ref|XP_004959556.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Setaria italica] Length = 628 Score = 100 bits (250), Expect = 3e-19 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK+VSKV REIIVRDTNRFHHFS+GSCSCGDYW Sbjct: 580 RIMKNIRICGDCHSAFKYVSKVFEREIIVRDTNRFHHFSNGSCSCGDYW 628 >ref|XP_004250455.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Solanum lycopersicum] Length = 653 Score = 100 bits (250), Expect = 3e-19 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCH+AFKFVSKV++REII+RDTNRFHHF +GSCSCGDYW Sbjct: 605 RIKKNIRVCGDCHTAFKFVSKVVDREIILRDTNRFHHFRNGSCSCGDYW 653 >tpg|DAA61963.1| TPA: hypothetical protein ZEAMMB73_954210 [Zea mays] Length = 633 Score = 100 bits (250), Expect = 3e-19 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK+VSKV REI+VRDTNRFHHFS+GSCSCGDYW Sbjct: 585 RIMKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSEGSCSCGDYW 633 >ref|NP_001145953.1| uncharacterized protein LOC100279479 [Zea mays] gi|219885099|gb|ACL52924.1| unknown [Zea mays] Length = 530 Score = 100 bits (250), Expect = 3e-19 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK+VSKV REI+VRDTNRFHHFS+GSCSCGDYW Sbjct: 482 RIMKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSEGSCSCGDYW 530 >gb|EMT26564.1| hypothetical protein F775_03208 [Aegilops tauschii] Length = 128 Score = 100 bits (249), Expect = 4e-19 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK+VSKV REI+VRDTNRFHHFS+GSCSCGDYW Sbjct: 80 RIMKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSNGSCSCGDYW 128 >ref|XP_004295338.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 650 Score = 100 bits (248), Expect = 5e-19 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCHSA K+VSKV REIIVRDTNRFHHF DGSCSCGDYW Sbjct: 602 RIKKNIRVCGDCHSAIKYVSKVERREIIVRDTNRFHHFRDGSCSCGDYW 650 >emb|CAJ26357.1| Selenium binding protein [Brachypodium sylvaticum] Length = 624 Score = 100 bits (248), Expect = 5e-19 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK++SKV REI+VRDTNRFHHFS+GSCSCGDYW Sbjct: 576 RIMKNIRICGDCHSAFKYISKVFEREIVVRDTNRFHHFSNGSCSCGDYW 624 >emb|CAJ19324.1| selenium binding protein [Triticum aestivum] Length = 624 Score = 99.8 bits (247), Expect = 7e-19 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK++SKV REI+VRDTNRFHHFS GSCSCGDYW Sbjct: 576 RIMKNIRICGDCHSAFKYISKVFGREIVVRDTNRFHHFSSGSCSCGDYW 624 >gb|EXB64625.1| hypothetical protein L484_017957 [Morus notabilis] Length = 750 Score = 99.4 bits (246), Expect = 9e-19 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCHSA K+VSKV+ REIIVRDTNRFHHF +GSCSCGDYW Sbjct: 702 RIKKNIRVCGDCHSAIKYVSKVVGREIIVRDTNRFHHFHNGSCSCGDYW 750 >ref|XP_002308737.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222854713|gb|EEE92260.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 590 Score = 99.4 bits (246), Expect = 9e-19 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCHSAFKFVSK++ REIIVRDTNRFHHF DG+CSC DYW Sbjct: 542 RIKKNIRICGDCHSAFKFVSKLVEREIIVRDTNRFHHFCDGACSCEDYW 590 >ref|XP_006467236.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Citrus sinensis] Length = 670 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +1 Query: 4 IKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 IKKNIR+CGDCHSAFKF SKV+ REIIVRDTNRFHHF DG CSCGDYW Sbjct: 623 IKKNIRVCGDCHSAFKFASKVVEREIIVRDTNRFHHFRDGFCSCGDYW 670 >ref|XP_006449977.1| hypothetical protein CICLE_v100176692mg, partial [Citrus clementina] gi|557552588|gb|ESR63217.1| hypothetical protein CICLE_v100176692mg, partial [Citrus clementina] Length = 206 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +1 Query: 4 IKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 IKKNIR+CGDCHSAFKF SKV+ REIIVRDTNRFHHF DG CSCGDYW Sbjct: 159 IKKNIRVCGDCHSAFKFASKVVEREIIVRDTNRFHHFRDGFCSCGDYW 206 >gb|EEE51036.1| hypothetical protein OsJ_31684 [Oryza sativa Japonica Group] Length = 637 Score = 98.6 bits (244), Expect = 2e-18 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAF+++SKV REI+VRDTNRFHHFS GSCSCGDYW Sbjct: 589 RIMKNIRICGDCHSAFRYISKVFKREIVVRDTNRFHHFSSGSCSCGDYW 637 >emb|CBI18780.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 98.6 bits (244), Expect = 2e-18 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCH+A KFVSKV++REIIVRDTNRFH F DGSCSCGDYW Sbjct: 241 RIKKNIRVCGDCHAAIKFVSKVVDREIIVRDTNRFHRFRDGSCSCGDYW 289 >gb|EEC67055.1| hypothetical protein OsI_33800 [Oryza sativa Indica Group] Length = 513 Score = 98.6 bits (244), Expect = 2e-18 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAF+++SKV REI+VRDTNRFHHFS GSCSCGDYW Sbjct: 465 RIMKNIRICGDCHSAFRYISKVFEREIVVRDTNRFHHFSSGSCSCGDYW 513 >ref|XP_007026426.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590627358|ref|XP_007026427.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590627361|ref|XP_007026428.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781792|gb|EOY29048.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781793|gb|EOY29049.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781794|gb|EOY29050.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 675 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RIKKNIR+CGDCHSA KFVS+V+ REIIVRDTNRFHHF GSCSCGDYW Sbjct: 627 RIKKNIRVCGDCHSAIKFVSQVVRREIIVRDTNRFHHFRGGSCSCGDYW 675 >dbj|BAJ96548.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 624 Score = 97.8 bits (242), Expect = 3e-18 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAFK++SKV REI+VRDTNRFHHFS+GSCSC DYW Sbjct: 576 RIMKNIRICGDCHSAFKYISKVFGREIVVRDTNRFHHFSNGSCSCADYW 624 >ref|XP_002460419.1| hypothetical protein SORBIDRAFT_02g027830 [Sorghum bicolor] gi|241923796|gb|EER96940.1| hypothetical protein SORBIDRAFT_02g027830 [Sorghum bicolor] Length = 635 Score = 97.8 bits (242), Expect = 3e-18 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KNIR+CGDCHSAF++VS+V REI+VRDTNRFHHFS+GSCSCGDYW Sbjct: 587 RIMKNIRICGDCHSAFRYVSEVFKREIVVRDTNRFHHFSNGSCSCGDYW 635 >ref|XP_006447804.1| hypothetical protein CICLE_v10017893mg [Citrus clementina] gi|568830346|ref|XP_006469462.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Citrus sinensis] gi|557550415|gb|ESR61044.1| hypothetical protein CICLE_v10017893mg [Citrus clementina] Length = 1057 Score = 97.1 bits (240), Expect = 5e-18 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +1 Query: 1 RIKKNIRMCGDCHSAFKFVSKVMNREIIVRDTNRFHHFSDGSCSCGDYW 147 RI KN+R+CGDCHSAFKF+SK++ REI++RD+NRFHHF+DG CSCGDYW Sbjct: 1009 RIMKNLRVCGDCHSAFKFISKIVGREIVLRDSNRFHHFNDGKCSCGDYW 1057