BLASTX nr result
ID: Akebia24_contig00029119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029119 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266125.2| PREDICTED: cell division control protein 2 h... 113 2e-23 emb|CAN84154.1| hypothetical protein VITISV_034166 [Vitis vinifera] 113 2e-23 ref|XP_006849186.1| hypothetical protein AMTR_s00027p00202830 [A... 111 9e-23 ref|XP_006482418.1| PREDICTED: cell division control protein 2 h... 111 1e-22 ref|XP_006430938.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430937.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430936.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430935.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430932.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430931.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430930.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 ref|XP_006430929.1| hypothetical protein CICLE_v10012320mg [Citr... 111 1e-22 gb|AAC41680.1| protein kinase p34cdc2 [Petroselinum crispum] 111 1e-22 dbj|BAE80323.1| cyclin dependent kinase A [Camellia sinensis] 111 1e-22 emb|CBJ18166.1| cyclin dependent kinase A [Cucurbita maxima] 111 1e-22 ref|XP_001780521.1| predicted protein [Physcomitrella patens] gi... 111 1e-22 emb|CAD43850.1| cell division cycle protein 2 [Daucus carota] 111 1e-22 sp|Q38772.2|CDC2A_ANTMA RecName: Full=Cell division control prot... 110 2e-22 emb|CAA66233.1| cyclin-dependent kinase [Antirrhinum majus] 110 2e-22 ref|XP_006364720.1| PREDICTED: cell division control protein 2 h... 110 2e-22 >ref|XP_002266125.2| PREDICTED: cell division control protein 2 homolog [Vitis vinifera] gi|297744790|emb|CBI38058.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 113 bits (283), Expect = 2e-23 Identities = 53/61 (86%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FLHQI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKMFLHQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >emb|CAN84154.1| hypothetical protein VITISV_034166 [Vitis vinifera] Length = 294 Score = 113 bits (283), Expect = 2e-23 Identities = 53/61 (86%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FLHQI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKMFLHQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >ref|XP_006849186.1| hypothetical protein AMTR_s00027p00202830 [Amborella trichopoda] gi|548852673|gb|ERN10767.1| hypothetical protein AMTR_s00027p00202830 [Amborella trichopoda] Length = 299 Score = 111 bits (278), Expect = 9e-23 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 108 VIKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 167 Query: 12 E 10 E Sbjct: 168 E 168 >ref|XP_006482418.1| PREDICTED: cell division control protein 2 homolog isoform X4 [Citrus sinensis] Length = 243 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 46 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 105 Query: 12 E 10 E Sbjct: 106 E 106 >ref|XP_006430938.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532995|gb|ESR44178.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 224 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >ref|XP_006430937.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532994|gb|ESR44177.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 165 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 46 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 105 Query: 12 E 10 E Sbjct: 106 E 106 >ref|XP_006430936.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532993|gb|ESR44176.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 204 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >ref|XP_006430935.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|568857725|ref|XP_006482415.1| PREDICTED: cell division control protein 2 homolog isoform X1 [Citrus sinensis] gi|568857727|ref|XP_006482416.1| PREDICTED: cell division control protein 2 homolog isoform X2 [Citrus sinensis] gi|557532992|gb|ESR44175.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 300 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >ref|XP_006430932.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|567876689|ref|XP_006430934.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532989|gb|ESR44172.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532991|gb|ESR44174.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >ref|XP_006430931.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532988|gb|ESR44171.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 237 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 46 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 105 Query: 12 E 10 E Sbjct: 106 E 106 >ref|XP_006430930.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|567876687|ref|XP_006430933.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|568857729|ref|XP_006482417.1| PREDICTED: cell division control protein 2 homolog isoform X3 [Citrus sinensis] gi|557532987|gb|ESR44170.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532990|gb|ESR44173.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >ref|XP_006430929.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] gi|557532986|gb|ESR44169.1| hypothetical protein CICLE_v10012320mg [Citrus clementina] Length = 192 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >gb|AAC41680.1| protein kinase p34cdc2 [Petroselinum crispum] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >dbj|BAE80323.1| cyclin dependent kinase A [Camellia sinensis] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >emb|CBJ18166.1| cyclin dependent kinase A [Cucurbita maxima] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 183 KFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTHE 10 +FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTHE Sbjct: 106 RFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHE 163 >ref|XP_001780521.1| predicted protein [Physcomitrella patens] gi|162667999|gb|EDQ54615.1| predicted protein [Physcomitrella patens] gi|343960558|dbj|BAK64050.1| cyclin-dependent kinase A;2 [Physcomitrella patens] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >emb|CAD43850.1| cell division cycle protein 2 [Daucus carota] Length = 294 Score = 111 bits (277), Expect = 1e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LIKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >sp|Q38772.2|CDC2A_ANTMA RecName: Full=Cell division control protein 2 homolog A Length = 294 Score = 110 bits (276), Expect = 2e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163 >emb|CAA66233.1| cyclin-dependent kinase [Antirrhinum majus] Length = 302 Score = 110 bits (276), Expect = 2e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 111 LVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 170 Query: 12 E 10 E Sbjct: 171 E 171 >ref|XP_006364720.1| PREDICTED: cell division control protein 2 homolog A-like [Solanum tuberosum] Length = 294 Score = 110 bits (276), Expect = 2e-22 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = -1 Query: 192 ILPKFLHQIFRGIAYCHSHRVLH*DLKPQNLLIDRRTNALKVADFGLVRAFGIPVRTFTH 13 ++ FL+QI RGIAYCHSHRVLH DLKPQNLLIDRRTNALK+ADFGL RAFGIPVRTFTH Sbjct: 103 LVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTH 162 Query: 12 E 10 E Sbjct: 163 E 163