BLASTX nr result
ID: Akebia24_contig00027770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00027770 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220917.1| hypothetical protein PRUPE_ppa000213mg [Prun... 61 2e-07 >ref|XP_007220917.1| hypothetical protein PRUPE_ppa000213mg [Prunus persica] gi|462417379|gb|EMJ22116.1| hypothetical protein PRUPE_ppa000213mg [Prunus persica] Length = 1454 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -2 Query: 199 DLGQLSKNHA-SNVKLKNTNSLPDSSERASSKSLHGSGGVSNEEKSDGSDREEVHVVMDV 23 DL QLSK HA S+ K+ +T SL SSE+A LHG G+ N EK D S E HV M+ Sbjct: 461 DLEQLSKKHADSSSKIGSTGSLRSSSEKAPDSLLHGDSGIPNGEKCDRSSTMECHVAMES 520 Query: 22 SPDVPGD 2 +PDV + Sbjct: 521 APDVSAE 527