BLASTX nr result
ID: Akebia24_contig00027736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00027736 (682 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 gb|EXC17374.1| hypothetical protein L484_027566 [Morus notabilis] 71 4e-10 ref|XP_006423060.1| hypothetical protein CICLE_v10028118mg [Citr... 71 4e-10 ref|XP_004292451.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_006480134.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_007042371.1| Tetratricopeptide repeat (TPR)-like superfam... 70 8e-10 ref|XP_006346446.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_004231403.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_007201996.1| hypothetical protein PRUPE_ppa024918mg [Prun... 65 2e-08 ref|XP_002521858.1| pentatricopeptide repeat-containing protein,... 65 3e-08 ref|XP_007153169.1| hypothetical protein PHAVU_003G012700g [Phas... 64 5e-08 ref|XP_002313097.2| hypothetical protein POPTR_0009s10870g [Popu... 64 6e-08 ref|XP_003556634.2| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_004498166.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 >ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vitis vinifera] Length = 762 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKPIISGG 141 L++AE+ KVLVEINHKEGNM+AV NVLT+MA +GLLPNSGK +GG Sbjct: 716 LNEAELAKVLVEINHKEGNMEAVLNVLTDMAKDGLLPNSGKTAYAGG 762 >gb|EXC17374.1| hypothetical protein L484_027566 [Morus notabilis] Length = 749 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKPIISGG 141 L DAE+ KVLVEINHKEGNMDAVF+VL+EMA +GLLPNSG GG Sbjct: 703 LTDAELAKVLVEINHKEGNMDAVFSVLSEMAKDGLLPNSGMTAYVGG 749 >ref|XP_006423060.1| hypothetical protein CICLE_v10028118mg [Citrus clementina] gi|557524994|gb|ESR36300.1| hypothetical protein CICLE_v10028118mg [Citrus clementina] Length = 557 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGK 123 L DAE+ KVLVEINHKEGNMDAV NVLTEMA +GLLPNSG+ Sbjct: 512 LSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGR 552 >ref|XP_004292451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Fragaria vesca subsp. vesca] Length = 751 Score = 70.1 bits (170), Expect = 6e-10 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKPIISGG 141 L DAE+ K+LVE NHKEGNMDAVFNVL EMA +GLLPNSG +GG Sbjct: 705 LTDAEVAKLLVETNHKEGNMDAVFNVLGEMAQDGLLPNSGVTTCAGG 751 >ref|XP_006480134.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Citrus sinensis] Length = 766 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSG 120 L DAE+ KVLVEINHKEGNMDAV NVLTEMA +GLLPNSG Sbjct: 721 LTDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSG 760 >ref|XP_007042371.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508706306|gb|EOX98202.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 745 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSG 120 L DAE+ KVLVEINHKEGNMDA FNVLTEMA +GLLPNSG Sbjct: 706 LIDAELAKVLVEINHKEGNMDAAFNVLTEMAKDGLLPNSG 745 >ref|XP_006346446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Solanum tuberosum] gi|565359285|ref|XP_006346447.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Solanum tuberosum] Length = 767 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGK 123 L D E+ KV+VE+N+KEGNMDAVFN LTEMA +GLLPNSGK Sbjct: 719 LADGELAKVIVEVNYKEGNMDAVFNALTEMAKDGLLPNSGK 759 >ref|XP_004231403.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Solanum lycopersicum] Length = 824 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGK 123 L D E+ KV+VE+N+KEGNMDAVFN LTEMA +GLLPNSGK Sbjct: 776 LADGELAKVIVEVNYKEGNMDAVFNALTEMAKDGLLPNSGK 816 >ref|XP_007201996.1| hypothetical protein PRUPE_ppa024918mg [Prunus persica] gi|462397527|gb|EMJ03195.1| hypothetical protein PRUPE_ppa024918mg [Prunus persica] Length = 618 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKPIISGG 141 L DAE+ K+ V+INHKEGNMD VFNVL++MA +GLLPNSG +GG Sbjct: 572 LSDAELAKLHVDINHKEGNMDEVFNVLSDMAKDGLLPNSGVRASAGG 618 >ref|XP_002521858.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538896|gb|EEF40494.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 533 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKP 126 L DAE+ KVLVEIN KEGNMD VFN+LTEMA +GL+P++G P Sbjct: 485 LTDAELSKVLVEINQKEGNMDMVFNLLTEMAKDGLIPSTGTP 526 >ref|XP_007153169.1| hypothetical protein PHAVU_003G012700g [Phaseolus vulgaris] gi|561026523|gb|ESW25163.1| hypothetical protein PHAVU_003G012700g [Phaseolus vulgaris] Length = 767 Score = 63.9 bits (154), Expect = 5e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKPIISGG*T 147 L+DAE+ KVLVE+N KEGNMDAV NVLTEMA +GLLP+ G ++ G T Sbjct: 719 LNDAEVAKVLVEVNFKEGNMDAVLNVLTEMAKDGLLPDGGMHSLALGST 767 >ref|XP_002313097.2| hypothetical protein POPTR_0009s10870g [Populus trichocarpa] gi|550331476|gb|EEE87052.2| hypothetical protein POPTR_0009s10870g [Populus trichocarpa] Length = 751 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSGKPIISG 138 L DAE+ K LV+INHKEGN+DAVFN+LTEMA +G LP+ P +G Sbjct: 705 LSDAELSKALVQINHKEGNIDAVFNLLTEMAKDGFLPSGAAPANAG 750 >ref|XP_003556634.2| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Glycine max] gi|571563372|ref|XP_006605469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Glycine max] Length = 778 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSG 120 L+DA++ KVLVE+N KEGNMDAV NVLTEMA +GLLP+ G Sbjct: 730 LNDAKVAKVLVEVNFKEGNMDAVLNVLTEMAKDGLLPDGG 769 >ref|XP_004498166.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Cicer arietinum] gi|502123561|ref|XP_004498167.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like isoform X2 [Cicer arietinum] Length = 749 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 1 LDDAEIEKVLVEINHKEGNMDAVFNVLTEMAYNGLLPNSG 120 L+DAE+ K LVEIN KEGNMDAV NVLTEMA +GLLP+ G Sbjct: 700 LNDAELPKALVEINFKEGNMDAVLNVLTEMASDGLLPDGG 739