BLASTX nr result
ID: Akebia24_contig00027345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00027345 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77987.1| hypothetical protein VITISV_015002 [Vitis vinifera] 91 2e-16 ref|XP_002282946.1| PREDICTED: uncharacterized protein LOC100247... 90 3e-16 gb|EXB77525.1| Beta-lactamase-like protein 2 [Morus notabilis] 87 2e-15 ref|XP_007221804.1| hypothetical protein PRUPE_ppa004908mg [Prun... 83 5e-14 ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|22... 82 1e-13 ref|XP_007044270.1| Metallo-hydrolase/oxidoreductase superfamily... 81 2e-13 ref|XP_007044269.1| Metallo-hydrolase/oxidoreductase superfamily... 81 2e-13 ref|XP_007044268.1| Metallo-hydrolase/oxidoreductase superfamily... 81 2e-13 ref|XP_006468734.1| PREDICTED: uncharacterized protein LOC102626... 77 2e-12 ref|XP_006468733.1| PREDICTED: uncharacterized protein LOC102626... 77 2e-12 ref|XP_006468732.1| PREDICTED: uncharacterized protein LOC102626... 77 2e-12 ref|XP_006448434.1| hypothetical protein CICLE_v10014910mg [Citr... 77 2e-12 ref|XP_006448432.1| hypothetical protein CICLE_v10014910mg [Citr... 77 2e-12 ref|XP_006448431.1| hypothetical protein CICLE_v10014910mg [Citr... 77 2e-12 ref|XP_006448430.1| hypothetical protein CICLE_v10014910mg [Citr... 77 2e-12 ref|XP_006448429.1| hypothetical protein CICLE_v10014910mg [Citr... 77 2e-12 ref|XP_004497068.1| PREDICTED: uncharacterized protein LOC101491... 75 1e-11 ref|XP_004497067.1| PREDICTED: uncharacterized protein LOC101491... 75 1e-11 ref|XP_002315930.2| hypothetical protein POPTR_0010s13170g [Popu... 74 2e-11 ref|XP_006378473.1| hypothetical protein POPTR_0010s13170g [Popu... 74 2e-11 >emb|CAN77987.1| hypothetical protein VITISV_015002 [Vitis vinifera] Length = 839 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/67 (67%), Positives = 51/67 (76%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 NE+EFLLV++SPPPK G EEYDSY DSDLWDLP T N L EG SQ + VEGAES +K Sbjct: 15 NEDEFLLVKESPPPKFGEEEYDSYFDSDLWDLPSTQLN-LLEGESQCGVXVEGAESVLDK 73 Query: 187 FNLRKFD 207 +L KFD Sbjct: 74 IDLTKFD 80 >ref|XP_002282946.1| PREDICTED: uncharacterized protein LOC100247470 [Vitis vinifera] gi|297737790|emb|CBI26991.3| unnamed protein product [Vitis vinifera] Length = 488 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/67 (67%), Positives = 51/67 (76%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 NE+EFLLV++SPPPK G EEYDSY DSDLWDLP T N L EG SQ + VEGAES +K Sbjct: 15 NEDEFLLVKESPPPKFGEEEYDSYFDSDLWDLPSTQLN-LLEGESQCGVSVEGAESVLDK 73 Query: 187 FNLRKFD 207 +L KFD Sbjct: 74 IDLTKFD 80 >gb|EXB77525.1| Beta-lactamase-like protein 2 [Morus notabilis] Length = 552 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/67 (64%), Positives = 48/67 (71%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 NE EFLLV+Q PP+ G EEYDS+ DSDLWDLP T NPL EG S+ I + AESCSE Sbjct: 15 NEAEFLLVKQKRPPQFGDEEYDSFADSDLWDLPSTRLNPL-EGESEPPISIHDAESCSEM 73 Query: 187 FNLRKFD 207 LRKFD Sbjct: 74 IELRKFD 80 >ref|XP_007221804.1| hypothetical protein PRUPE_ppa004908mg [Prunus persica] gi|462418740|gb|EMJ23003.1| hypothetical protein PRUPE_ppa004908mg [Prunus persica] Length = 486 Score = 82.8 bits (203), Expect = 5e-14 Identities = 43/67 (64%), Positives = 48/67 (71%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+ PPK EEYDSYVDSDLWDLP T N LE S+ I VEGAES S K Sbjct: 16 NDAEFLLVKQTRPPKFNDEEYDSYVDSDLWDLPSTQLNLLEV-KSEPSIAVEGAESWSGK 74 Query: 187 FNLRKFD 207 L+KFD Sbjct: 75 IELKKFD 81 >ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|223533641|gb|EEF35378.1| catalytic, putative [Ricinus communis] Length = 526 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/66 (59%), Positives = 49/66 (74%) Frame = +1 Query: 10 EEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEKF 189 E EFLL++QSPPPKLG EEYDS+VDSDLWDLP T N L +G + I+++G +S KF Sbjct: 16 EAEFLLIKQSPPPKLGNEEYDSFVDSDLWDLPSTKLN-LVDGELEPAILIDGMDSHLGKF 74 Query: 190 NLRKFD 207 N K+D Sbjct: 75 NATKYD 80 >ref|XP_007044270.1| Metallo-hydrolase/oxidoreductase superfamily protein isoform 3 [Theobroma cacao] gi|508708205|gb|EOY00102.1| Metallo-hydrolase/oxidoreductase superfamily protein isoform 3 [Theobroma cacao] Length = 513 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ +FLL++Q+PPPK G +EYDSYVDS LWDLP T N L+E S I+++G ES S+K Sbjct: 15 NDSQFLLLKQTPPPKFGEDEYDSYVDSHLWDLPSTLLN-LQENASHPGILIQGEESFSDK 73 Query: 187 FNLRKFD 207 ++ KFD Sbjct: 74 IDMTKFD 80 >ref|XP_007044269.1| Metallo-hydrolase/oxidoreductase superfamily protein, putative isoform 2 [Theobroma cacao] gi|508708204|gb|EOY00101.1| Metallo-hydrolase/oxidoreductase superfamily protein, putative isoform 2 [Theobroma cacao] Length = 486 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ +FLL++Q+PPPK G +EYDSYVDS LWDLP T N L+E S I+++G ES S+K Sbjct: 15 NDSQFLLLKQTPPPKFGEDEYDSYVDSHLWDLPSTLLN-LQENASHPGILIQGEESFSDK 73 Query: 187 FNLRKFD 207 ++ KFD Sbjct: 74 IDMTKFD 80 >ref|XP_007044268.1| Metallo-hydrolase/oxidoreductase superfamily protein isoform 1 [Theobroma cacao] gi|508708203|gb|EOY00100.1| Metallo-hydrolase/oxidoreductase superfamily protein isoform 1 [Theobroma cacao] Length = 518 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ +FLL++Q+PPPK G +EYDSYVDS LWDLP T N L+E S I+++G ES S+K Sbjct: 15 NDSQFLLLKQTPPPKFGEDEYDSYVDSHLWDLPSTLLN-LQENASHPGILIQGEESFSDK 73 Query: 187 FNLRKFD 207 ++ KFD Sbjct: 74 IDMTKFD 80 >ref|XP_006468734.1| PREDICTED: uncharacterized protein LOC102626745 isoform X3 [Citrus sinensis] Length = 418 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006468733.1| PREDICTED: uncharacterized protein LOC102626745 isoform X2 [Citrus sinensis] Length = 433 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006468732.1| PREDICTED: uncharacterized protein LOC102626745 isoform X1 [Citrus sinensis] Length = 522 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIKLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006448434.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|557551045|gb|ESR61674.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] Length = 301 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIQLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006448432.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|557551043|gb|ESR61672.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] Length = 522 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIQLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006448431.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|557551042|gb|ESR61671.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] Length = 485 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIQLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006448430.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|567912239|ref|XP_006448433.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|557551041|gb|ESR61670.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|557551044|gb|ESR61673.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] Length = 439 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIQLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_006448429.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] gi|557551040|gb|ESR61669.1| hypothetical protein CICLE_v10014910mg [Citrus clementina] Length = 425 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = +1 Query: 7 NEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSEK 186 N+ EFLLV+Q+PPPK EEYDSYVDSDLWDLP N ++ S+ I ++G SEK Sbjct: 15 NDSEFLLVKQTPPPKFNDEEYDSYVDSDLWDLPAIQLNHIQGEKSEPTISIQG----SEK 70 Query: 187 FNLRKFD 207 NL KFD Sbjct: 71 INLGKFD 77 >ref|XP_004497068.1| PREDICTED: uncharacterized protein LOC101491135 isoform X2 [Cicer arietinum] Length = 490 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/68 (54%), Positives = 45/68 (66%) Frame = +1 Query: 4 SNEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSE 183 SN EFLL +QS PPK EEYDS+VDSDLWDLP NPL+ S+ + V + S SE Sbjct: 15 SNHNEFLLAKQSRPPKFNDEEYDSFVDSDLWDLPSVHLNPLQPD-SEPTVEVNISASLSE 73 Query: 184 KFNLRKFD 207 +FN +FD Sbjct: 74 EFNFNEFD 81 >ref|XP_004497067.1| PREDICTED: uncharacterized protein LOC101491135 isoform X1 [Cicer arietinum] Length = 527 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/68 (54%), Positives = 45/68 (66%) Frame = +1 Query: 4 SNEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEGVSQSKIVVEGAESCSE 183 SN EFLL +QS PPK EEYDS+VDSDLWDLP NPL+ S+ + V + S SE Sbjct: 15 SNHNEFLLAKQSRPPKFNDEEYDSFVDSDLWDLPSVHLNPLQPD-SEPTVEVNISASLSE 73 Query: 184 KFNLRKFD 207 +FN +FD Sbjct: 74 EFNFNEFD 81 >ref|XP_002315930.2| hypothetical protein POPTR_0010s13170g [Populus trichocarpa] gi|550329707|gb|EEF02101.2| hypothetical protein POPTR_0010s13170g [Populus trichocarpa] Length = 480 Score = 74.3 bits (181), Expect = 2e-11 Identities = 40/69 (57%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = +1 Query: 4 SNEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEG-VSQSKIVVEGAESCS 180 S+E EFLL +Q+PPPK G EEYD++VDSDLWDLP T + LEEG + S IV+EG Sbjct: 14 SDEAEFLLAKQNPPPKFGIEEYDTFVDSDLWDLPSTKLD-LEEGELESSSIVIEGL---- 68 Query: 181 EKFNLRKFD 207 E+ +L KFD Sbjct: 69 ERTDLGKFD 77 >ref|XP_006378473.1| hypothetical protein POPTR_0010s13170g [Populus trichocarpa] gi|550329706|gb|ERP56270.1| hypothetical protein POPTR_0010s13170g [Populus trichocarpa] Length = 490 Score = 74.3 bits (181), Expect = 2e-11 Identities = 40/69 (57%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = +1 Query: 4 SNEEEFLLVRQSPPPKLGTEEYDSYVDSDLWDLPWTSFNPLEEG-VSQSKIVVEGAESCS 180 S+E EFLL +Q+PPPK G EEYD++VDSDLWDLP T + LEEG + S IV+EG Sbjct: 14 SDEAEFLLAKQNPPPKFGIEEYDTFVDSDLWDLPSTKLD-LEEGELESSSIVIEGL---- 68 Query: 181 EKFNLRKFD 207 E+ +L KFD Sbjct: 69 ERTDLGKFD 77