BLASTX nr result
ID: Akebia24_contig00024959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024959 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 gb|EXB63584.1| hypothetical protein L484_026923 [Morus notabilis] 69 9e-10 gb|AFW87128.1| hypothetical protein ZEAMMB73_335999 [Zea mays] 68 2e-09 gb|AFW85303.1| hypothetical protein ZEAMMB73_833402 [Zea mays] 68 2e-09 gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays su... 66 6e-09 gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays su... 66 6e-09 ref|XP_006398023.1| hypothetical protein EUTSA_v10001258mg [Eutr... 60 2e-07 ref|XP_002529560.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 69.3 bits (168), Expect = 5e-10 Identities = 39/50 (78%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMGHSFSLSH--KKKGVGG 55 MARKGNPISVRLDLNRSSDSS FSEGDRESHR S L KKK VGG Sbjct: 1 MARKGNPISVRLDLNRSSDSSRFSEGDRESHRKWVSLFLCPILKKKSVGG 50 >gb|EXB63584.1| hypothetical protein L484_026923 [Morus notabilis] Length = 64 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMGH 94 MARKGNPISVRLDLNRSSDSS FSEGDRESHRMG+ Sbjct: 1 MARKGNPISVRLDLNRSSDSSRFSEGDRESHRMGY 35 >gb|AFW87128.1| hypothetical protein ZEAMMB73_335999 [Zea mays] Length = 387 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMGHSF 88 MARKGNPISVRLDLNRSSD S FSEGDRESHRMG F Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESHRMGSEF 37 >gb|AFW85303.1| hypothetical protein ZEAMMB73_833402 [Zea mays] Length = 607 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMGHSF 88 MARKGNPISVRLDLNRSSD S FSEGDRESHRMG F Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESHRMGSEF 37 >gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|102579661|gb|ABF70941.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 163 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMG 97 MARKGNPISVRLDLNRSSD S FSEGDRESHRMG Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESHRMG 34 >gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|93116158|gb|ABE98789.1| hypothetical protein [Zea mays subsp. mays] gi|413954480|gb|AFW87129.1| putative uncharacterized protein orf127 [Zea mays] Length = 159 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMG 97 MARKGNPISVRLDLNRSSD S FSEGDRESHRMG Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESHRMG 34 >ref|XP_006398023.1| hypothetical protein EUTSA_v10001258mg [Eutrema salsugineum] gi|557099105|gb|ESQ39476.1| hypothetical protein EUTSA_v10001258mg [Eutrema salsugineum] Length = 121 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRM 100 MARKGNPISVRL NRSSDSS FSEGDRESHRM Sbjct: 46 MARKGNPISVRLGKNRSSDSSRFSEGDRESHRM 78 >ref|XP_002529560.1| conserved hypothetical protein [Ricinus communis] gi|223530972|gb|EEF32829.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = -3 Query: 198 MARKGNPISVRLDLNRSSDSSWFSEGDRESHRMGHSFSLS---HKKKG 64 MARKGNPISVRLDLNRSSDSS FSEGD ESH+ S L KK+G Sbjct: 1 MARKGNPISVRLDLNRSSDSSRFSEGDCESHQKWASLFLCPILKKKRG 48