BLASTX nr result
ID: Akebia24_contig00024591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024591 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267076.1| PREDICTED: erlin-2-B [Vitis vinifera] gi|297... 58 1e-06 ref|XP_006837139.1| hypothetical protein AMTR_s00110p00140670 [A... 55 8e-06 >ref|XP_002267076.1| PREDICTED: erlin-2-B [Vitis vinifera] gi|297738083|emb|CBI27284.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 1 IANNSKIFFGDKVPSMVFDQRLLGNFLQTKGK 96 IANNSKIFFG+KVP+MVFDQRLLGNFLQ+ K Sbjct: 340 IANNSKIFFGNKVPNMVFDQRLLGNFLQSVAK 371 >ref|XP_006837139.1| hypothetical protein AMTR_s00110p00140670 [Amborella trichopoda] gi|548839732|gb|ERM99992.1| hypothetical protein AMTR_s00110p00140670 [Amborella trichopoda] Length = 336 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 1 IANNSKIFFGDKVPSMVFDQRLLGNFLQ 84 IANNSKIFFGDKVP M+FDQRL+GNFL+ Sbjct: 301 IANNSKIFFGDKVPGMIFDQRLIGNFLK 328