BLASTX nr result
ID: Akebia24_contig00024571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024571 (208 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56433.1| GTP-binding protein ERG [Morus notabilis] 58 1e-06 ref|XP_002274221.1| PREDICTED: GTP-binding protein ERG-like [Vit... 58 1e-06 emb|CBI27222.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAN83131.1| hypothetical protein VITISV_029539 [Vitis vinifera] 58 1e-06 ref|XP_004972587.1| PREDICTED: GTP-binding protein ERG-like [Set... 57 3e-06 gb|AFW56995.1| hypothetical protein ZEAMMB73_674370 [Zea mays] 57 3e-06 gb|AFW56992.1| hypothetical protein ZEAMMB73_674370 [Zea mays] g... 57 3e-06 ref|XP_002444026.1| hypothetical protein SORBIDRAFT_07g006070 [S... 57 3e-06 gb|ACN34076.1| unknown [Zea mays] gi|413921066|gb|AFW60998.1| hy... 57 3e-06 ref|XP_006369061.1| GTP-binding protein ERG [Populus trichocarpa... 57 3e-06 gb|EMS67900.1| GTP-binding protein ERG [Triticum urartu] 56 5e-06 ref|XP_004295512.1| PREDICTED: GTP-binding protein ERG-like [Fra... 56 5e-06 ref|XP_007211735.1| hypothetical protein PRUPE_ppa006209mg [Prun... 56 5e-06 ref|XP_002516653.1| GTP-binding protein erg, putative [Ricinus c... 56 5e-06 ref|XP_006363190.1| PREDICTED: GTP-binding protein ERG-like [Sol... 56 6e-06 ref|XP_007041013.1| GTP-binding family protein isoform 2 [Theobr... 56 6e-06 ref|XP_007041012.1| GTP-binding family protein isoform 1 [Theobr... 56 6e-06 ref|XP_004232641.1| PREDICTED: GTP-binding protein ERG-like [Sol... 56 6e-06 >gb|EXB56433.1| GTP-binding protein ERG [Morus notabilis] Length = 465 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +GNTQICFF Sbjct: 182 VGTKVAAVSRKTNTTTHEVLGVMTKGNTQICFF 214 >ref|XP_002274221.1| PREDICTED: GTP-binding protein ERG-like [Vitis vinifera] Length = 423 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +GNTQICFF Sbjct: 160 VGTKVAAVSRKTNTTTHEVLGVMTKGNTQICFF 192 >emb|CBI27222.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +GNTQICFF Sbjct: 160 VGTKVAAVSRKTNTTTHEVLGVMTKGNTQICFF 192 >emb|CAN83131.1| hypothetical protein VITISV_029539 [Vitis vinifera] Length = 928 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +GNTQICFF Sbjct: 626 VGTKVAAVSRKTNTTTHEVLGVMTKGNTQICFF 658 >ref|XP_004972587.1| PREDICTED: GTP-binding protein ERG-like [Setaria italica] Length = 437 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHE+LGV+ +GNTQICFF Sbjct: 169 VGTKVAAVSRKTNTTTHEILGVLTKGNTQICFF 201 >gb|AFW56995.1| hypothetical protein ZEAMMB73_674370 [Zea mays] Length = 291 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHE+LGV+ +GNTQICFF Sbjct: 23 VGTKVAAVSRKTNTTTHEILGVLTKGNTQICFF 55 >gb|AFW56992.1| hypothetical protein ZEAMMB73_674370 [Zea mays] gi|413917061|gb|AFW56993.1| hypothetical protein ZEAMMB73_674370 [Zea mays] gi|413917062|gb|AFW56994.1| hypothetical protein ZEAMMB73_674370 [Zea mays] Length = 437 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHE+LGV+ +GNTQICFF Sbjct: 169 VGTKVAAVSRKTNTTTHEILGVLTKGNTQICFF 201 >ref|XP_002444026.1| hypothetical protein SORBIDRAFT_07g006070 [Sorghum bicolor] gi|241940376|gb|EES13521.1| hypothetical protein SORBIDRAFT_07g006070 [Sorghum bicolor] Length = 435 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHE+LGV+ +GNTQICFF Sbjct: 167 VGTKVAAVSRKTNTTTHEILGVLTKGNTQICFF 199 >gb|ACN34076.1| unknown [Zea mays] gi|413921066|gb|AFW60998.1| hypothetical protein ZEAMMB73_697996 [Zea mays] gi|413921067|gb|AFW60999.1| hypothetical protein ZEAMMB73_697996 [Zea mays] Length = 439 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHE+LGV+ +GNTQICFF Sbjct: 171 VGTKVAAVSRKTNTTTHEILGVLTKGNTQICFF 203 >ref|XP_006369061.1| GTP-binding protein ERG [Populus trichocarpa] gi|550347420|gb|ERP65630.1| GTP-binding protein ERG [Populus trichocarpa] Length = 428 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +G+TQICFF Sbjct: 165 VGTKVAAVSRKTNTTTHEVLGVMTDGDTQICFF 197 >gb|EMS67900.1| GTP-binding protein ERG [Triticum urartu] Length = 325 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 108 EVGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 EVG+KV VSRKTNTTTHE+LGV+ EG TQICFF Sbjct: 29 EVGSKVAAVSRKTNTTTHEILGVLTEGKTQICFF 62 >ref|XP_004295512.1| PREDICTED: GTP-binding protein ERG-like [Fragaria vesca subsp. vesca] Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKV-VVSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGV+ EG+TQICFF Sbjct: 167 VGTKVSAVSRKTNTTTHEVLGVITEGDTQICFF 199 >ref|XP_007211735.1| hypothetical protein PRUPE_ppa006209mg [Prunus persica] gi|462407600|gb|EMJ12934.1| hypothetical protein PRUPE_ppa006209mg [Prunus persica] Length = 422 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +G+TQICFF Sbjct: 159 VGTKVAAVSRKTNTTTHEVLGVMTKGDTQICFF 191 >ref|XP_002516653.1| GTP-binding protein erg, putative [Ricinus communis] gi|223544148|gb|EEF45672.1| GTP-binding protein erg, putative [Ricinus communis] Length = 427 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKV-VVSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +G+TQICFF Sbjct: 164 VGTKVSAVSRKTNTTTHEVLGVMTKGDTQICFF 196 >ref|XP_006363190.1| PREDICTED: GTP-binding protein ERG-like [Solanum tuberosum] Length = 440 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKV-VVSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +G TQICFF Sbjct: 176 VGTKVSAVSRKTNTTTHEVLGVMTKGKTQICFF 208 >ref|XP_007041013.1| GTP-binding family protein isoform 2 [Theobroma cacao] gi|508704948|gb|EOX96844.1| GTP-binding family protein isoform 2 [Theobroma cacao] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM G+TQICFF Sbjct: 153 VGTKVAAVSRKTNTTTHEVLGVMTRGDTQICFF 185 >ref|XP_007041012.1| GTP-binding family protein isoform 1 [Theobroma cacao] gi|508704947|gb|EOX96843.1| GTP-binding family protein isoform 1 [Theobroma cacao] Length = 417 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKVV-VSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM G+TQICFF Sbjct: 153 VGTKVAAVSRKTNTTTHEVLGVMTRGDTQICFF 185 >ref|XP_004232641.1| PREDICTED: GTP-binding protein ERG-like [Solanum lycopersicum] Length = 440 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/33 (84%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +3 Query: 111 VGTKV-VVSRKTNTTTHEVLGVMIEGNTQICFF 206 VGTKV VSRKTNTTTHEVLGVM +G TQICFF Sbjct: 176 VGTKVSAVSRKTNTTTHEVLGVMTKGKTQICFF 208