BLASTX nr result
ID: Akebia24_contig00024259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024259 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006595405.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 >ref|XP_006595405.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14820, mitochondrial-like [Glycine max] Length = 593 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/69 (43%), Positives = 39/69 (56%) Frame = +2 Query: 179 YALEIRDEEQEKDGFVDSKCAFLMVSLCPCXXXXXXXXXXXXXXXXAKFHLFCHTPFHSL 358 +AL IRD+ ++ + +SKCA+L+V+LCPC KFH FCHTP HS Sbjct: 12 FALSIRDDHRKDE---ESKCAYLVVALCPCLVCFVLLLIALSIILVVKFHFFCHTPLHS- 67 Query: 359 STLFYKKKC 385 L YKK C Sbjct: 68 --LLYKKNC 74