BLASTX nr result
ID: Akebia24_contig00024239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024239 (592 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON62801.1| hypothetical protein W97_02026 [Coniosporium apol... 58 2e-06 >gb|EON62801.1| hypothetical protein W97_02026 [Coniosporium apollinis CBS 100218] Length = 122 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/63 (44%), Positives = 38/63 (60%) Frame = +1 Query: 238 GLYQCGSADDGLGKYYESTRYTCFDGDILCPRLDGGRRTRPCGDACYDPRVYSCGDDDQL 417 G+ +CG+A Y + YTCFDG LCP ++ GR T+PCGD CYDP Y+C + Sbjct: 33 GIEECGNAG------YRPSEYTCFDGK-LCP-INNGRPTQPCGDHCYDPSQYNCQNGTLY 84 Query: 418 IGV 426 G+ Sbjct: 85 SGI 87