BLASTX nr result
ID: Akebia24_contig00023339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00023339 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, part... 59 9e-07 ref|XP_007207970.1| hypothetical protein PRUPE_ppa016339mg, part... 57 3e-06 emb|CAN79625.1| hypothetical protein VITISV_035899 [Vitis vinifera] 56 6e-06 >ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] gi|462395598|gb|EMJ01397.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] Length = 1057 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/63 (47%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +3 Query: 69 EFSHVLPLKMLDSVSPMRNIQYHTDLVLDASFPNLPRYRMSLKKHNILKEQLKKNLE-AF 245 +F +L K+ + + PMR+IQ+ DLV AS PNLP YRMS K+++IL+EQ+++ L+ F Sbjct: 233 QFQELLSEKLPNELPPMRDIQHRIDLVPGASLPNLPHYRMSPKENDILREQIEELLQKGF 292 Query: 246 INK 254 I K Sbjct: 293 IRK 295 >ref|XP_007207970.1| hypothetical protein PRUPE_ppa016339mg, partial [Prunus persica] gi|462403612|gb|EMJ09169.1| hypothetical protein PRUPE_ppa016339mg, partial [Prunus persica] Length = 566 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/57 (47%), Positives = 42/57 (73%) Frame = +3 Query: 69 EFSHVLPLKMLDSVSPMRNIQYHTDLVLDASFPNLPRYRMSLKKHNILKEQLKKNLE 239 +F +L K+ + + PMR+IQ+ DLV AS PNLP YRMS K+++IL+EQ+++ L+ Sbjct: 481 QFQELLSEKLPNELPPMRDIQHRIDLVPGASHPNLPHYRMSPKENDILREQIEELLQ 537 >emb|CAN79625.1| hypothetical protein VITISV_035899 [Vitis vinifera] Length = 866 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = +3 Query: 69 EFSHVLPLKMLDSVSPMRNIQYHTDLVLDASFPNLPRYRMSLKKHNILKEQLKKNLE 239 +F + P ++ + + PMRNIQ+H DLV AS PNLP YRMS +H L +QL + L+ Sbjct: 228 DFPDLSPNELPNELPPMRNIQHHIDLVPRASLPNLPHYRMSPTEHEELXQQLNELLD 284