BLASTX nr result
ID: Akebia24_contig00023301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00023301 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034591.1| CBS domain-containing protein with a domain ... 57 4e-06 ref|XP_006489290.1| PREDICTED: DUF21 domain-containing protein A... 56 5e-06 ref|XP_006419804.1| hypothetical protein CICLE_v10004788mg [Citr... 56 5e-06 >ref|XP_007034591.1| CBS domain-containing protein with a domain of Uncharacterized protein function isoform 1 [Theobroma cacao] gi|508713620|gb|EOY05517.1| CBS domain-containing protein with a domain of Uncharacterized protein function isoform 1 [Theobroma cacao] Length = 628 Score = 56.6 bits (135), Expect = 4e-06 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +1 Query: 1 EEIVDETDEYVDVHKRIXXXXXXXXXXXXXXXXXXXLIAQKGAAGTQNKQGTA-KKSGED 177 EEIVDETDEYVDVHKRI LI QKG AG Q+KQG A KK E Sbjct: 561 EEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKG-AGAQSKQGQATKKPAEG 619 Query: 178 DSGSMR 195 DS S R Sbjct: 620 DSNSTR 625 >ref|XP_006489290.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Citrus sinensis] Length = 508 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/68 (52%), Positives = 38/68 (55%), Gaps = 3/68 (4%) Frame = +1 Query: 1 EEIVDETDEYVDVHKRIXXXXXXXXXXXXXXXXXXXLIAQKGAA--GTQNKQG-TAKKSG 171 EEIVDETDEYVDVHKRI LI QKGAA G Q+KQG KK+ Sbjct: 430 EEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKGAANQGGQSKQGLPPKKAA 489 Query: 172 EDDSGSMR 195 E DS S R Sbjct: 490 ESDSSSTR 497 >ref|XP_006419804.1| hypothetical protein CICLE_v10004788mg [Citrus clementina] gi|557521677|gb|ESR33044.1| hypothetical protein CICLE_v10004788mg [Citrus clementina] Length = 508 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/68 (52%), Positives = 38/68 (55%), Gaps = 3/68 (4%) Frame = +1 Query: 1 EEIVDETDEYVDVHKRIXXXXXXXXXXXXXXXXXXXLIAQKGAA--GTQNKQG-TAKKSG 171 EEIVDETDEYVDVHKRI LI QKGAA G Q+KQG KK+ Sbjct: 430 EEIVDETDEYVDVHKRIRVAAAAAASSVARAPSSRRLIGQKGAANQGGQSKQGLPPKKAA 489 Query: 172 EDDSGSMR 195 E DS S R Sbjct: 490 ESDSSSTR 497