BLASTX nr result
ID: Akebia24_contig00023272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00023272 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD29815.1| NADH-plastoquinone oxidoreductase subunit 4 prote... 117 2e-24 gb|AEX96419.1| NADH-plastoquinone oxidoreductase subunit 4, part... 116 3e-24 gb|AEX96413.1| NADH-plastoquinone oxidoreductase subunit 4, part... 115 6e-24 gb|AEX96412.1| NADH-plastoquinone oxidoreductase subunit 4, part... 115 6e-24 ref|YP_740701.1| NADH-plastoquinone oxidoreductase subunit 4 [Na... 115 6e-24 ref|YP_008993742.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_008993828.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_008993484.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_008993398.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_008993570.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_008993312.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_008993226.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_007474585.1| NADH dehydrogenase subunit 4 (chloroplast) [... 114 1e-23 ref|YP_007474501.1| NADH dehydrogenase subunit 4 (chloroplast) [... 114 1e-23 ref|YP_007474418.1| NADH dehydrogenase subunit 4 (chloroplast) [... 114 1e-23 gb|AEX96447.1| NADH-plastoquinone oxidoreductase subunit 4, part... 114 1e-23 gb|AEX96401.1| NADH-plastoquinone oxidoreductase subunit 4, part... 114 1e-23 ref|YP_004769763.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 ref|YP_740252.1| NADH-plastoquinone oxidoreductase subunit 4 [Li... 114 1e-23 ref|YP_002836140.1| NADH-plastoquinone oxidoreductase subunit 4 ... 114 1e-23 >gb|ADD29815.1| NADH-plastoquinone oxidoreductase subunit 4 protein [Meliosma aff. cuneifolia Moore 333] Length = 500 Score = 117 bits (293), Expect = 2e-24 Identities = 56/63 (88%), Positives = 59/63 (93%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FNAPN+SF DSGPRELFVSI IFLPV+ IGIYPDFVLSLSVDKVEAILSNY Sbjct: 438 RQMFYGYKLFNAPNYSFFDSGPRELFVSISIFLPVIGIGIYPDFVLSLSVDKVEAILSNY 497 Query: 110 FYR 102 FYR Sbjct: 498 FYR 500 >gb|AEX96419.1| NADH-plastoquinone oxidoreductase subunit 4, partial (chloroplast) [Asphodeline damascena] Length = 500 Score = 116 bits (291), Expect = 3e-24 Identities = 54/63 (85%), Positives = 59/63 (93%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN +F+DSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKV+AILSNY Sbjct: 438 RQMFYGYKLFNVPNLNFVDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVQAILSNY 497 Query: 110 FYR 102 FYR Sbjct: 498 FYR 500 >gb|AEX96413.1| NADH-plastoquinone oxidoreductase subunit 4, partial (chloroplast) [Scadoxus cinnabarinus] Length = 500 Score = 115 bits (288), Expect = 6e-24 Identities = 54/63 (85%), Positives = 60/63 (95%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FNAPN +F+DSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKV+AILSNY Sbjct: 438 RQMFYGYKLFNAPNSNFVDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVQAILSNY 497 Query: 110 FYR 102 F+R Sbjct: 498 FHR 500 >gb|AEX96412.1| NADH-plastoquinone oxidoreductase subunit 4, partial (chloroplast) [Crinum asiaticum] Length = 500 Score = 115 bits (288), Expect = 6e-24 Identities = 54/63 (85%), Positives = 60/63 (95%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FNAPN +F+DSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKV+AILSNY Sbjct: 438 RQMFYGYKLFNAPNSNFVDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVQAILSNY 497 Query: 110 FYR 102 F+R Sbjct: 498 FHR 500 >ref|YP_740701.1| NADH-plastoquinone oxidoreductase subunit 4 [Nandina domestica] gi|122165917|sp|Q09FR0.1|NU4C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4, chloroplastic; AltName: Full=NAD(P)H dehydrogenase, chain 4; AltName: Full=NADH-plastoquinone oxidoreductase chain 4 gi|114054522|gb|ABI49915.1| NADH-plastoquinone oxidoreductase subunit 4 [Nandina domestica] Length = 500 Score = 115 bits (288), Expect = 6e-24 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQ+FYG+KQFN PN F DSGPRELFVSICIFLPV+ IGIYPDFV SLSVDKVEAILSNY Sbjct: 438 RQIFYGYKQFNVPNSHFFDSGPRELFVSICIFLPVIGIGIYPDFVFSLSVDKVEAILSNY 497 Query: 110 FYR 102 FYR Sbjct: 498 FYR 500 >ref|YP_008993742.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia salicifolia] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_008993828.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia sinica] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_008993484.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia kobus] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_008993398.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia pyramidata] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_008993570.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia liliifera] Length = 491 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 429 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 488 Query: 110 FYR 102 FY+ Sbjct: 489 FYK 491 >ref|YP_008993312.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia dealbata] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_008993226.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia cathcartii] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_007474585.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia grandiflora] gi|372862891|gb|AEX98967.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia grandiflora] gi|372863062|gb|AEX99136.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia grandiflora] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_007474501.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862553|gb|AEX98633.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862638|gb|AEX98717.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862723|gb|AEX98801.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia officinalis subsp. biloba] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_007474418.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia officinalis] gi|372862469|gb|AEX98550.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia officinalis] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >gb|AEX96447.1| NADH-plastoquinone oxidoreductase subunit 4, partial (chloroplast) [Xeronema callistemon] Length = 500 Score = 114 bits (286), Expect = 1e-23 Identities = 53/63 (84%), Positives = 59/63 (93%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN +FLDSGPRELFVSICIFLP++ IGIYPDFVLSLSVDKV+AILSNY Sbjct: 438 RQMFYGYKLFNVPNSNFLDSGPRELFVSICIFLPIIGIGIYPDFVLSLSVDKVQAILSNY 497 Query: 110 FYR 102 F+R Sbjct: 498 FHR 500 >gb|AEX96401.1| NADH-plastoquinone oxidoreductase subunit 4, partial (chloroplast) [Anemarrhena asphodeloides] Length = 500 Score = 114 bits (286), Expect = 1e-23 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN +FLDSGPRELFVSICIFLPVL IGIYPDFVLSLSVDKV+AILSNY Sbjct: 438 RQMFYGYKLFNVPNSNFLDSGPRELFVSICIFLPVLGIGIYPDFVLSLSVDKVQAILSNY 497 Query: 110 FYR 102 F R Sbjct: 498 FQR 500 >ref|YP_004769763.1| NADH-plastoquinone oxidoreductase subunit 4 [Magnolia kwangsiensis] gi|400256637|ref|YP_006576164.1| NdhD (chloroplast) [Magnolia denudata] gi|570760236|ref|YP_008993656.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia odora] gi|570772344|ref|YP_008993914.1| NADH-plastoquinone oxidoreductase subunit 4 (chloroplast) [Magnolia sprengeri] gi|619275785|ref|YP_009026931.1| NADH dehydrogenase subunit 4 [Magnolia tripetala] gi|302424229|gb|ADL39105.1| NADH-plastoquinone oxidoreductase subunit 4 [Magnolia kwangsiensis] gi|343887588|gb|AEM65267.1| NdhD [Magnolia denudata] gi|372862216|gb|AEX98300.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia liliiflora] gi|372862300|gb|AEX98383.1| NADH dehydrogenase subunit 4 (chloroplast) [Magnolia denudata] gi|608608453|gb|AHW52007.1| NADH dehydrogenase subunit 4 [Magnolia tripetala] Length = 492 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 430 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 489 Query: 110 FYR 102 FY+ Sbjct: 490 FYK 492 >ref|YP_740252.1| NADH-plastoquinone oxidoreductase subunit 4 [Liriodendron tulipifera] gi|122227463|sp|Q0G9G9.1|NU4C_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4, chloroplastic; AltName: Full=NAD(P)H dehydrogenase, chain 4; AltName: Full=NADH-plastoquinone oxidoreductase chain 4 gi|113201044|gb|ABI32559.1| NADH-plastoquinone oxidoreductase subunit 4 [Liriodendron tulipifera] Length = 500 Score = 114 bits (286), Expect = 1e-23 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+K FN PN FLDSGPRELFVSICIFLPV+ IGIYPDFVLSLSVDKVEAIL+NY Sbjct: 438 RQMFYGYKLFNVPNSYFLDSGPRELFVSICIFLPVIGIGIYPDFVLSLSVDKVEAILANY 497 Query: 110 FYR 102 FY+ Sbjct: 498 FYK 500 >ref|YP_002836140.1| NADH-plastoquinone oxidoreductase subunit 4 [Megaleranthis saniculifolia] gi|226933932|gb|ACO92065.1| NADH-plastoquinone oxidoreductase subunit 4 [Megaleranthis saniculifolia] Length = 500 Score = 114 bits (285), Expect = 1e-23 Identities = 52/63 (82%), Positives = 58/63 (92%) Frame = -2 Query: 290 RQMFYGHKQFNAPNFSFLDSGPRELFVSICIFLPVLSIGIYPDFVLSLSVDKVEAILSNY 111 RQMFYG+KQFN+ N FLDSGPRELF+SICIFLPV+ IGIYPDFVLSLS+DKVE I+SNY Sbjct: 438 RQMFYGYKQFNSQNSPFLDSGPRELFISICIFLPVIGIGIYPDFVLSLSIDKVETIISNY 497 Query: 110 FYR 102 FYR Sbjct: 498 FYR 500