BLASTX nr result
ID: Akebia24_contig00023052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00023052 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511120.1| DNA binding protein, putative [Ricinus commu... 56 6e-06 >ref|XP_002511120.1| DNA binding protein, putative [Ricinus communis] gi|223550235|gb|EEF51722.1| DNA binding protein, putative [Ricinus communis] Length = 2299 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -2 Query: 448 GPSQR-KVNKEEPQMAPSRTFIRAFRPSSLMRSMDLTIKDKQSVSG 314 GPS+R K NKE+PQMAPSR FIR F PSS+ S+DL K K V G Sbjct: 530 GPSRRRKTNKEDPQMAPSRKFIRPFNPSSVGLSLDLLFKGKSEVFG 575