BLASTX nr result
ID: Akebia24_contig00022445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00022445 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD83485.2| hypothetical protein (mitochondrion) [Nicotiana ... 61 4e-08 ref|YP_173421.1| hypothetical protein NitaMp079 [Nicotiana tabacum] 59 2e-07 pir||S42982 hypothetical protein 224 - evening primrose mitochon... 58 1e-06 emb|CAN65168.1| hypothetical protein VITISV_029402 [Vitis vinifera] 54 5e-06 >dbj|BAD83485.2| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 216 Score = 61.2 bits (147), Expect(2) = 4e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 204 RGGIQKRLMMSIYLSRLFPRSNSSFLLCSGNALQS 308 RGG +K+LMMSIYLSRLFPRSNSSF LCSGNALQS Sbjct: 9 RGG-KKKLMMSIYLSRLFPRSNSSFFLCSGNALQS 42 Score = 21.9 bits (45), Expect(2) = 4e-08 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 185 MLLINRKRRNTKK 223 MLLINR RR KK Sbjct: 1 MLLINRTRRGGKK 13 >ref|YP_173421.1| hypothetical protein NitaMp079 [Nicotiana tabacum] Length = 216 Score = 58.9 bits (141), Expect(2) = 2e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 204 RGGIQKRLMMSIYLSRLFPRSNSSFLLCSGNALQS 308 RGG +K+LMMSIYLSR FPRSNSSF LCSGNALQS Sbjct: 9 RGG-KKKLMMSIYLSRSFPRSNSSFFLCSGNALQS 42 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 185 MLLINRKRRNTKK 223 MLLINR RR KK Sbjct: 1 MLLINRTRRGGKK 13 >pir||S42982 hypothetical protein 224 - evening primrose mitochondrion gi|459533|emb|CAA54968.1| rps1 [Oenothera berteroana] Length = 224 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 201 GRGGIQKRLMMSIYLSRLFPRSNSSFLLCSGNALQS 308 GRGG +K+ +MSIYLSR F RSNSSF LCSGNALQS Sbjct: 8 GRGGKKKKQLMSIYLSRSFTRSNSSFFLCSGNALQS 43 >emb|CAN65168.1| hypothetical protein VITISV_029402 [Vitis vinifera] Length = 217 Score = 54.3 bits (129), Expect(2) = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 219 KRLMMSIYLSRLFPRSNSSFLLCSGNALQS 308 K+LMMSIYLSR FPRSNSSF LCSGNA QS Sbjct: 13 KKLMMSIYLSRSFPRSNSSFFLCSGNASQS 42 Score = 21.6 bits (44), Expect(2) = 5e-06 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 185 MLLINRKRRNTKK 223 MLLINRKRR K Sbjct: 1 MLLINRKRRKKIK 13