BLASTX nr result
ID: Akebia24_contig00022403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00022403 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298494.1| hypothetical protein POPTR_0001s28740g [Popu... 100 2e-19 gb|ABK95593.1| unknown [Populus trichocarpa] 100 2e-19 ref|XP_004166686.1| PREDICTED: LRR repeats and ubiquitin-like do... 100 3e-19 ref|XP_004143220.1| PREDICTED: uncharacterized protein LOC101207... 99 6e-19 ref|XP_007205369.1| hypothetical protein PRUPE_ppa007247mg [Prun... 99 8e-19 ref|XP_007016952.1| Typical subtype, Leucine-rich repeat, Ubiqui... 98 1e-18 ref|XP_007016951.1| Typical subtype, Leucine-rich repeat, Ubiqui... 98 1e-18 ref|XP_002526616.1| leucine-rich repeat containing protein, puta... 98 1e-18 gb|EXB37969.1| LRR repeats and ubiquitin-like domain-containing ... 97 2e-18 ref|XP_006344060.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 2e-18 ref|XP_002275653.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 2e-18 emb|CAN65127.1| hypothetical protein VITISV_005830 [Vitis vinifera] 97 2e-18 ref|XP_004296059.1| PREDICTED: uncharacterized protein LOC101292... 96 4e-18 ref|XP_004240413.1| PREDICTED: LRR repeats and ubiquitin-like do... 96 4e-18 ref|XP_003552940.1| PREDICTED: LRR repeats and ubiquitin-like do... 95 9e-18 gb|AFK46182.1| unknown [Lotus japonicus] 94 2e-17 ref|XP_002879249.1| ubiquitin family protein [Arabidopsis lyrata... 93 3e-17 ref|XP_007146815.1| hypothetical protein PHAVU_006G072100g [Phas... 91 1e-16 gb|AFK42552.1| unknown [Lotus japonicus] 91 1e-16 ref|XP_004500301.1| PREDICTED: LRR repeats and ubiquitin-like do... 91 2e-16 >ref|XP_002298494.1| hypothetical protein POPTR_0001s28740g [Populus trichocarpa] gi|222845752|gb|EEE83299.1| hypothetical protein POPTR_0001s28740g [Populus trichocarpa] Length = 371 Score = 100 bits (250), Expect = 2e-19 Identities = 49/65 (75%), Positives = 58/65 (89%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 + I VKFSGRSIP+S+S DS +KD+KSLLQPLTNVLPRGQKLI KGK+LVD MTL+ SE+ Sbjct: 10 INITVKFSGRSIPISVSLDSKIKDVKSLLQPLTNVLPRGQKLIFKGKLLVDGMTLRESEV 69 Query: 245 TNGSK 259 TNG+K Sbjct: 70 TNGAK 74 >gb|ABK95593.1| unknown [Populus trichocarpa] Length = 371 Score = 100 bits (250), Expect = 2e-19 Identities = 49/65 (75%), Positives = 58/65 (89%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 + I VKFSGRSIP+S+S DS +KD+KSLLQPLTNVLPRGQKLI KGK+LVD MTL+ SE+ Sbjct: 10 INITVKFSGRSIPISVSLDSKIKDVKSLLQPLTNVLPRGQKLIFKGKLLVDGMTLRESEV 69 Query: 245 TNGSK 259 TNG+K Sbjct: 70 TNGAK 74 >ref|XP_004166686.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Cucumis sativus] Length = 367 Score = 100 bits (248), Expect = 3e-19 Identities = 49/69 (71%), Positives = 59/69 (85%) Frame = +2 Query: 53 ASQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLK 232 A+ ++I VKF+G+SIP++L DSTVKDLKSLLQPLTNVLPRGQKLI KGK+L D MTL Sbjct: 2 ANSSISINVKFTGKSIPITLPPDSTVKDLKSLLQPLTNVLPRGQKLIFKGKVLADEMTLA 61 Query: 233 ASEITNGSK 259 ASE+ NG+K Sbjct: 62 ASEVANGAK 70 >ref|XP_004143220.1| PREDICTED: uncharacterized protein LOC101207176 [Cucumis sativus] Length = 1290 Score = 99.0 bits (245), Expect = 6e-19 Identities = 48/65 (73%), Positives = 57/65 (87%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 ++I VKF+G+SIP++L DSTVKDLKSLLQPLTNVLPRGQKLI KGK+L D MTL ASE+ Sbjct: 929 ISINVKFTGKSIPITLPPDSTVKDLKSLLQPLTNVLPRGQKLIFKGKVLADEMTLAASEV 988 Query: 245 TNGSK 259 NG+K Sbjct: 989 ANGAK 993 >ref|XP_007205369.1| hypothetical protein PRUPE_ppa007247mg [Prunus persica] gi|462401011|gb|EMJ06568.1| hypothetical protein PRUPE_ppa007247mg [Prunus persica] Length = 376 Score = 98.6 bits (244), Expect = 8e-19 Identities = 49/66 (74%), Positives = 59/66 (89%), Gaps = 1/66 (1%) Frame = +2 Query: 65 LTIQVKFSGRSIPVS-LSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASE 241 +++ VKFSGR+IP++ LS DST+KDLKSLLQPLTNVLPRGQKLI KGK+LVD MTLK SE Sbjct: 15 ISLSVKFSGRTIPITNLSPDSTIKDLKSLLQPLTNVLPRGQKLICKGKLLVDGMTLKESE 74 Query: 242 ITNGSK 259 + NGS+ Sbjct: 75 VANGSR 80 >ref|XP_007016952.1| Typical subtype, Leucine-rich repeat, Ubiquitin, Ubiquitin supergroup isoform 2 [Theobroma cacao] gi|508787315|gb|EOY34571.1| Typical subtype, Leucine-rich repeat, Ubiquitin, Ubiquitin supergroup isoform 2 [Theobroma cacao] Length = 386 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/65 (73%), Positives = 56/65 (86%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 + I VKFSGRSIP+S++ DST+KDLKS LQ LTNVLPRGQKLI KGK+LVD MTLK SE+ Sbjct: 12 INITVKFSGRSIPISIAKDSTIKDLKSHLQSLTNVLPRGQKLIFKGKLLVDAMTLKESEV 71 Query: 245 TNGSK 259 NG+K Sbjct: 72 MNGAK 76 >ref|XP_007016951.1| Typical subtype, Leucine-rich repeat, Ubiquitin, Ubiquitin supergroup isoform 1 [Theobroma cacao] gi|508787314|gb|EOY34570.1| Typical subtype, Leucine-rich repeat, Ubiquitin, Ubiquitin supergroup isoform 1 [Theobroma cacao] Length = 373 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/65 (73%), Positives = 56/65 (86%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 + I VKFSGRSIP+S++ DST+KDLKS LQ LTNVLPRGQKLI KGK+LVD MTLK SE+ Sbjct: 12 INITVKFSGRSIPISIAKDSTIKDLKSHLQSLTNVLPRGQKLIFKGKLLVDAMTLKESEV 71 Query: 245 TNGSK 259 NG+K Sbjct: 72 MNGAK 76 >ref|XP_002526616.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223534056|gb|EEF35775.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 353 Score = 98.2 bits (243), Expect = 1e-18 Identities = 49/68 (72%), Positives = 57/68 (83%) Frame = +2 Query: 56 SQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKA 235 S + I VKFSGRSIP+S+S +STV+DLK LLQPLTNVLPRGQKLI KG++L DTMTL Sbjct: 8 SNTINITVKFSGRSIPISVSLNSTVRDLKCLLQPLTNVLPRGQKLICKGRVLTDTMTLMQ 67 Query: 236 SEITNGSK 259 SE+TNG K Sbjct: 68 SELTNGVK 75 >gb|EXB37969.1| LRR repeats and ubiquitin-like domain-containing protein [Morus notabilis] Length = 377 Score = 97.4 bits (241), Expect = 2e-18 Identities = 48/65 (73%), Positives = 57/65 (87%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 ++I VKFSG I +S+S DST+K LKSLLQPLTNVLPRGQKLI KGK+LVD MT++ASE+ Sbjct: 15 ISINVKFSGGLIAISVSPDSTIKHLKSLLQPLTNVLPRGQKLIFKGKLLVDEMTIRASEV 74 Query: 245 TNGSK 259 TNGSK Sbjct: 75 TNGSK 79 >ref|XP_006344060.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Solanum tuberosum] Length = 376 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/65 (73%), Positives = 57/65 (87%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 +T+ VKFSGRSIPV +S +STVK LKSLLQPLTNVL RGQKLI KGK+LVD +TLK+SE+ Sbjct: 15 ITVNVKFSGRSIPVEISDESTVKHLKSLLQPLTNVLSRGQKLIFKGKVLVDEITLKSSEV 74 Query: 245 TNGSK 259 NG+K Sbjct: 75 GNGAK 79 >ref|XP_002275653.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Vitis vinifera] gi|297745853|emb|CBI15909.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/65 (73%), Positives = 58/65 (89%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 +T+ +KFSGRSIPVS+S +STVKDLKSLLQPLTNVL RGQKLI KG++L D MTL+ SEI Sbjct: 19 ITLNIKFSGRSIPVSVSPNSTVKDLKSLLQPLTNVLTRGQKLIFKGRVLADGMTLRESEI 78 Query: 245 TNGSK 259 T+G+K Sbjct: 79 TDGAK 83 >emb|CAN65127.1| hypothetical protein VITISV_005830 [Vitis vinifera] Length = 380 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/65 (73%), Positives = 58/65 (89%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 +T+ +KFSGRSIPVS+S +STVKDLKSLLQPLTNVL RGQKLI KG++L D MTL+ SEI Sbjct: 19 ITLNIKFSGRSIPVSVSPNSTVKDLKSLLQPLTNVLTRGQKLIFKGRVLADGMTLRESEI 78 Query: 245 TNGSK 259 T+G+K Sbjct: 79 TDGAK 83 >ref|XP_004296059.1| PREDICTED: uncharacterized protein LOC101292395 [Fragaria vesca subsp. vesca] Length = 1304 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/66 (72%), Positives = 60/66 (90%), Gaps = 1/66 (1%) Frame = +2 Query: 65 LTIQVKFSGRSIPV-SLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASE 241 +++ VKF+G++IP+ +LS DSTVKDLK+LLQPLTNVLPRGQKLISKGK+LVD MTL+ SE Sbjct: 945 ISLSVKFAGQTIPIKNLSPDSTVKDLKALLQPLTNVLPRGQKLISKGKLLVDAMTLRESE 1004 Query: 242 ITNGSK 259 I NG+K Sbjct: 1005 IGNGAK 1010 >ref|XP_004240413.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Solanum lycopersicum] Length = 375 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/68 (69%), Positives = 59/68 (86%) Frame = +2 Query: 56 SQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKA 235 ++ +T+ V+FSGRSIPV +S +STVK LKSLLQPLTNVL RGQKLI KGK+LVD +TLK+ Sbjct: 11 NRTITVNVRFSGRSIPVEISDESTVKHLKSLLQPLTNVLSRGQKLIFKGKVLVDEVTLKS 70 Query: 236 SEITNGSK 259 SE+ NG+K Sbjct: 71 SEVGNGAK 78 >ref|XP_003552940.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Glycine max] Length = 375 Score = 95.1 bits (235), Expect = 9e-18 Identities = 48/65 (73%), Positives = 56/65 (86%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 +TI VKFSG SIP+S+S +ST+KDLKSLL P TNVLPRGQKLI KGK+L D MTL AS++ Sbjct: 16 ITINVKFSGVSIPISISPNSTIKDLKSLLLPSTNVLPRGQKLIFKGKVLEDPMTLTASKL 75 Query: 245 TNGSK 259 TNGSK Sbjct: 76 TNGSK 80 >gb|AFK46182.1| unknown [Lotus japonicus] Length = 208 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/69 (68%), Positives = 56/69 (81%) Frame = +2 Query: 53 ASQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLK 232 ++ +TI VKFSG SIP+S+S ST+KDLKSLL P TNVLPRGQKLI KGK+L D MTL Sbjct: 15 SNSTITISVKFSGASIPISISPHSTIKDLKSLLLPATNVLPRGQKLIFKGKVLEDPMTLT 74 Query: 233 ASEITNGSK 259 AS ++NGSK Sbjct: 75 ASNLSNGSK 83 >ref|XP_002879249.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] gi|297325088|gb|EFH55508.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] Length = 900 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/69 (65%), Positives = 57/69 (82%) Frame = +2 Query: 53 ASQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLK 232 A + + VKF G+SIP+S+S D TVKDLKSLLQP+TNVLPRGQKLI KGK+LV+T TLK Sbjct: 535 ADSTIKLTVKFGGKSIPLSVSQDCTVKDLKSLLQPITNVLPRGQKLIFKGKVLVETSTLK 594 Query: 233 ASEITNGSK 259 S++ +G+K Sbjct: 595 QSDVGSGAK 603 >ref|XP_007146815.1| hypothetical protein PHAVU_006G072100g [Phaseolus vulgaris] gi|561020038|gb|ESW18809.1| hypothetical protein PHAVU_006G072100g [Phaseolus vulgaris] Length = 369 Score = 91.3 bits (225), Expect = 1e-16 Identities = 45/65 (69%), Positives = 55/65 (84%) Frame = +2 Query: 65 LTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLKASEI 244 +TI VKF+G +IP+S+S +ST+KDLKSLL P TNVLPRGQKLI KGK+L D +TL AS + Sbjct: 10 ITINVKFNGVTIPISISPNSTIKDLKSLLLPSTNVLPRGQKLIFKGKVLEDPLTLTASNL 69 Query: 245 TNGSK 259 TNGSK Sbjct: 70 TNGSK 74 >gb|AFK42552.1| unknown [Lotus japonicus] Length = 378 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/69 (66%), Positives = 55/69 (79%) Frame = +2 Query: 53 ASQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLK 232 ++ +TI VKFSG SIP+S+S ST+KDLKSLL P TNVLPRGQK I KGK+L D MTL Sbjct: 15 SNSTITISVKFSGASIPISISPHSTIKDLKSLLLPATNVLPRGQKHIFKGKVLEDPMTLT 74 Query: 233 ASEITNGSK 259 AS ++NGSK Sbjct: 75 ASNLSNGSK 83 >ref|XP_004500301.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Cicer arietinum] Length = 374 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = +2 Query: 53 ASQILTIQVKFSGRSIPVSLSSDSTVKDLKSLLQPLTNVLPRGQKLISKGKMLVDTMTLK 232 A+ +T+ VKFSG +IP+S+S ST+K+LKSLL PLTNVLPRGQK+I KGK+L D +TL Sbjct: 11 ATTTITLSVKFSGSTIPISISPQSTIKELKSLLLPLTNVLPRGQKIIFKGKVLEDPITLS 70 Query: 233 ASEITNGSK 259 AS + NGSK Sbjct: 71 ASNLINGSK 79