BLASTX nr result
ID: Akebia24_contig00022298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00022298 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535170.1| conserved hypothetical protein [Ricinus comm... 115 5e-24 ref|XP_002536285.1| conserved hypothetical protein [Ricinus comm... 91 2e-16 ref|XP_002529239.1| conserved hypothetical protein [Ricinus comm... 74 2e-13 >ref|XP_002535170.1| conserved hypothetical protein [Ricinus communis] gi|255598352|ref|XP_002536987.1| conserved hypothetical protein [Ricinus communis] gi|223517891|gb|EEF25396.1| conserved hypothetical protein [Ricinus communis] gi|223523842|gb|EEF27215.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 115 bits (289), Expect = 5e-24 Identities = 56/66 (84%), Positives = 61/66 (92%) Frame = +1 Query: 82 EACRACCRGDKKRLSRGDPVTVMNVEE*GI*LVTIPIGGRTNAAGGVQNRPAEDGRVNVV 261 +A RACC+GDKKRLSRGDPVT+MNVEE GI LVT+P+ RTNAAGGVQNRPAEDGRVNVV Sbjct: 3 QASRACCKGDKKRLSRGDPVTIMNVEEWGILLVTVPMFRRTNAAGGVQNRPAEDGRVNVV 62 Query: 262 EPRARE 279 EPRARE Sbjct: 63 EPRARE 68 >ref|XP_002536285.1| conserved hypothetical protein [Ricinus communis] gi|223520179|gb|EEF26097.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +1 Query: 82 EACRACCRGDKKRLSRGDPVTVMNVEE*GI*LVTIPIGGRTNAAGGVQNRPAE 240 +A RACC+GDKKRLSRGDPVT+MNVEE GI LVT+P+ RTNAAGGVQNRPAE Sbjct: 32 QASRACCKGDKKRLSRGDPVTIMNVEEWGILLVTVPMFRRTNAAGGVQNRPAE 84 >ref|XP_002529239.1| conserved hypothetical protein [Ricinus communis] gi|223531312|gb|EEF33152.1| conserved hypothetical protein [Ricinus communis] Length = 58 Score = 74.3 bits (181), Expect(2) = 2e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 82 EACRACCRGDKKRLSRGDPVTVMNVEE*GI*LVTIPIGGRTNAAG 216 +A RACC+GDKKRLSRGDPVT+MNVEE GI LVT+P+ RTNAAG Sbjct: 3 QASRACCKGDKKRLSRGDPVTIMNVEEWGILLVTVPMFRRTNAAG 47 Score = 26.9 bits (58), Expect(2) = 2e-13 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 215 GECRIDQQKMEE 250 GECRIDQ KMEE Sbjct: 47 GECRIDQLKMEE 58