BLASTX nr result
ID: Akebia24_contig00022071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00022071 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006280949.1| ribosomal protein S2 (mitochondrion) [Spirod... 98 1e-18 gb|AHA47127.1| ribosomal protein S2 (mitochondrion) [Amborella t... 93 4e-17 ref|YP_005090383.1| ribosomal protein S2 (mitochondrion) [Phoeni... 57 5e-12 dbj|BAJ22098.1| ribosomal protein S2 [Cycas taitungensis] 65 1e-08 ref|YP_007905716.1| ribosomal protein S2 (mitochondrion) [Liriod... 59 5e-07 >ref|YP_006280949.1| ribosomal protein S2 (mitochondrion) [Spirodela polyrhiza] gi|385252651|gb|AFI54959.1| ribosomal protein S2 (mitochondrion) [Spirodela polyrhiza] Length = 219 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +1 Query: 1 IPANDSIQFVYLFCNLITKTVLLERGRIVAMKETAGEETTHRSTFSKKNWF 153 IPAND IQFVYLF N ITKTVLLERGRIVAMKETAGEETTHRSTFSKKNWF Sbjct: 169 IPANDPIQFVYLFRNSITKTVLLERGRIVAMKETAGEETTHRSTFSKKNWF 219 >gb|AHA47127.1| ribosomal protein S2 (mitochondrion) [Amborella trichopoda] Length = 221 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = +1 Query: 1 IPANDSIQFVYLFCNLITKTVLLERGRIVAMKETAGEETTHRSTFSKKNWF 153 IPAND IQFVYLF N ITKTVLLERGRI+AMKETAGEE THRSTFSKK WF Sbjct: 171 IPANDPIQFVYLFRNSITKTVLLERGRIIAMKETAGEERTHRSTFSKKKWF 221 >ref|YP_005090383.1| ribosomal protein S2 (mitochondrion) [Phoenix dactylifera] gi|343478435|gb|AEM43923.1| ribosomal protein S2 (mitochondrion) [Phoenix dactylifera] Length = 226 Score = 56.6 bits (135), Expect(3) = 5e-12 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 IPANDSIQFVYLFCNLITKTVLLERGRIVAMKE 99 IPAND IQFVYLF + ITKTV+LERGRIVAMKE Sbjct: 169 IPANDPIQFVYLFRHSITKTVILERGRIVAMKE 201 Score = 36.2 bits (82), Expect(3) = 5e-12 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 107 EKKQLIDRPFPRRIGF 154 EKK+LIDRPFPRRIGF Sbjct: 201 EKKELIDRPFPRRIGF 216 Score = 23.1 bits (48), Expect(3) = 5e-12 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 135 FQEELVLVDRSSGQIPS 185 F + DRSSGQIPS Sbjct: 210 FPRRIGFFDRSSGQIPS 226 >dbj|BAJ22098.1| ribosomal protein S2 [Cycas taitungensis] Length = 216 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 IPANDSIQFVYLFCNLITKTVLLERGRIVAMK 96 IPANDSIQFVYLFCNLITKTVLLERG+IVAMK Sbjct: 185 IPANDSIQFVYLFCNLITKTVLLERGKIVAMK 216 >ref|YP_007905716.1| ribosomal protein S2 (mitochondrion) [Liriodendron tulipifera] gi|480541920|gb|AGJ90413.1| ribosomal protein S2 (mitochondrion) [Liriodendron tulipifera] Length = 206 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +1 Query: 1 IPANDSIQFVYLFCNLITKTVLLERGRIVAMKE 99 IPAND IQFVYLF N ITKTVLLERGRIVAMKE Sbjct: 170 IPANDPIQFVYLFRNSITKTVLLERGRIVAMKE 202