BLASTX nr result
ID: Akebia24_contig00021466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00021466 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Viti... 99 5e-19 ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like ... 99 6e-19 sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase... 98 1e-18 gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera] 98 1e-18 ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase-like ... 98 1e-18 ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like ... 98 1e-18 ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like ... 98 1e-18 ref|XP_002268773.1| PREDICTED: phenylalanine ammonia-lyase [Viti... 98 1e-18 ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Viti... 98 1e-18 ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Viti... 98 1e-18 ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Viti... 98 1e-18 emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera] 98 1e-18 emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera] 98 1e-18 gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera] 98 1e-18 gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena le... 97 2e-18 ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-lik... 97 2e-18 gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia] 97 2e-18 dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata] 96 4e-18 gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera] 96 4e-18 gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot ... 96 4e-18 >ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGEEFDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSGWNGAPLPIC 710 >ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera] Length = 710 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGEEFDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEEFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >sp|P45735.1|PALY_VITVI RecName: Full=Phenylalanine ammonia-lyase gi|1345583|emb|CAA53581.1| phenylalanine ammonium lyase [Vitis vinifera] Length = 416 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 367 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 416 >gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >ref|XP_003635685.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera] Length = 308 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 259 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 308 >ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >ref|XP_002268773.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera] Length = 707 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 658 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 707 >emb|CAN61378.1| hypothetical protein VITISV_032212 [Vitis vinifera] Length = 686 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 637 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 686 >gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera] Length = 710 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTAM EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPIC 710 >gb|AEW43005.1| phenylalanine ammonia lyase, partial [Leucaena leucocephala] Length = 365 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGEEFDK+FTAM EGK+IDPLLDCL WNGAP+P+C Sbjct: 316 ELGTGLLTGEKVRSPGEEFDKVFTAMCEGKLIDPLLDCLKGWNGAPLPLC 365 >ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine max] Length = 712 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGEEFDKLFTAM +GK+IDPLL+CL +WNGAP+PIC Sbjct: 663 ELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC 712 >gb|ACF94717.1| phenylalanine ammonia lyase [Robinia pseudoacacia] Length = 311 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGEEFDKLFTAM +GK+IDPLL+CL +WNGAP+PIC Sbjct: 262 ELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLLECLGEWNGAPLPIC 311 >dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata] Length = 715 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKV+SPGEEFDKLFTA+ +GK+IDPLL+CL DWNGAP+PIC Sbjct: 666 ELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGDWNGAPLPIC 715 >gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera] Length = 710 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 ELGTGLLTGEKVRSPGE+FDK+FTA+ EGK+IDPLLDCLS WNGAP+PIC Sbjct: 661 ELGTGLLTGEKVRSPGEDFDKVFTAICEGKIIDPLLDCLSAWNGAPLPIC 710 >gb|AAK60273.1|AF383150_1 phenylalanine ammonia-lyase 3 [Manihot esculenta] Length = 315 Score = 96.3 bits (238), Expect = 4e-18 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +3 Query: 3 ELGTGLLTGEKVRSPGEEFDKLFTAMNEGKMIDPLLDCLSDWNGAPIPIC 152 E+GTGLLTGEKVRSPGEEFDK+FTAM +GK+IDP+LDCL +WNGAP+PIC Sbjct: 266 EIGTGLLTGEKVRSPGEEFDKVFTAMCQGKIIDPMLDCLKEWNGAPLPIC 315