BLASTX nr result
ID: Akebia24_contig00021289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00021289 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42581.1| hypothetical protein MIMGU_mgv1a001050mg [Mimulus... 100 2e-19 ref|XP_006344398.1| PREDICTED: pantothenate kinase 2-like isofor... 97 2e-18 ref|XP_007036235.1| Pantothenate kinase 2 isoform 2, partial [Th... 97 2e-18 ref|XP_007036234.1| Pantothenate kinase 2 isoform 1 [Theobroma c... 97 2e-18 ref|XP_004236210.1| PREDICTED: pantothenate kinase 2-like [Solan... 97 2e-18 ref|XP_002318651.1| hypothetical protein POPTR_0012s08310g [Popu... 97 2e-18 gb|EXB87894.1| Pantothenate kinase 2 [Morus notabilis] 96 5e-18 gb|EPS64631.1| hypothetical protein M569_10149, partial [Genlise... 96 5e-18 ref|XP_007210380.1| hypothetical protein PRUPE_ppa001094mg [Prun... 96 7e-18 ref|XP_002511391.1| Pantothenate kinase, putative [Ricinus commu... 96 7e-18 ref|XP_002867254.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata] g... 95 9e-18 gb|AAM20690.1| putative protein [Arabidopsis thaliana] 95 1e-17 ref|XP_006282554.1| hypothetical protein CARUB_v10004099mg [Caps... 95 1e-17 ref|XP_004152477.1| PREDICTED: pantothenate kinase 2-like [Cucum... 95 1e-17 ref|NP_001031768.1| pantothenate kinase 2 [Arabidopsis thaliana]... 95 1e-17 ref|NP_194945.3| pantothenate kinase 2 [Arabidopsis thaliana] gi... 95 1e-17 pir||T05410 hypothetical protein F10M6.180 - Arabidopsis thalian... 95 1e-17 ref|XP_006412505.1| hypothetical protein EUTSA_v10024357mg [Eutr... 93 3e-17 ref|XP_003576771.1| PREDICTED: pantothenate kinase 2-like [Brach... 93 3e-17 emb|CBI15019.3| unnamed protein product [Vitis vinifera] 92 8e-17 >gb|EYU42581.1| hypothetical protein MIMGU_mgv1a001050mg [Mimulus guttatus] Length = 904 Score = 100 bits (250), Expect = 2e-19 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRSSSRPQLD+SGAAIQGN EERDPTILLPNQSDDISHLALDIGGSLIKLV Sbjct: 44 IHRSSSRPQLDLSGAAIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLV 95 >ref|XP_006344398.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Solanum tuberosum] gi|565355013|ref|XP_006344399.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Solanum tuberosum] gi|565355015|ref|XP_006344400.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Solanum tuberosum] Length = 901 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRSSSRPQLDVSGAAIQGN EE+DP ILLPNQ+DDISHLALDIGGSLIKL+ Sbjct: 42 IHRSSSRPQLDVSGAAIQGNFEEKDPAILLPNQTDDISHLALDIGGSLIKLI 93 >ref|XP_007036235.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao] gi|508773480|gb|EOY20736.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao] Length = 919 Score = 97.4 bits (241), Expect = 2e-18 Identities = 52/62 (83%), Positives = 54/62 (87%), Gaps = 3/62 (4%) Frame = +2 Query: 179 RLMAPPV---IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIK 349 R MAPP IHRS SRPQLD+S AAIQG+ EERDPTILLPNQSDDISHLALDIGGSLIK Sbjct: 61 RDMAPPASNSIHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLIK 120 Query: 350 LV 355 LV Sbjct: 121 LV 122 >ref|XP_007036234.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao] gi|508773479|gb|EOY20735.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao] Length = 973 Score = 97.4 bits (241), Expect = 2e-18 Identities = 52/62 (83%), Positives = 54/62 (87%), Gaps = 3/62 (4%) Frame = +2 Query: 179 RLMAPPV---IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIK 349 R MAPP IHRS SRPQLD+S AAIQG+ EERDPTILLPNQSDDISHLALDIGGSLIK Sbjct: 61 RDMAPPASNSIHRSGSRPQLDLSKAAIQGSSEERDPTILLPNQSDDISHLALDIGGSLIK 120 Query: 350 LV 355 LV Sbjct: 121 LV 122 >ref|XP_004236210.1| PREDICTED: pantothenate kinase 2-like [Solanum lycopersicum] Length = 901 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRSSSRPQLDVSGAAIQGN EE+DP ILLPNQ+DDISHLALDIGGSLIKL+ Sbjct: 42 IHRSSSRPQLDVSGAAIQGNFEEKDPAILLPNQTDDISHLALDIGGSLIKLI 93 >ref|XP_002318651.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa] gi|222859324|gb|EEE96871.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa] Length = 939 Score = 97.4 bits (241), Expect = 2e-18 Identities = 51/62 (82%), Positives = 53/62 (85%), Gaps = 3/62 (4%) Frame = +2 Query: 179 RLMAPPV---IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIK 349 R M PP IHRS SRPQLD+S AAI+GN EERDPTILLPNQSDDISHLALDIGGSLIK Sbjct: 65 RDMVPPTSTSIHRSGSRPQLDLSKAAIEGNFEERDPTILLPNQSDDISHLALDIGGSLIK 124 Query: 350 LV 355 LV Sbjct: 125 LV 126 >gb|EXB87894.1| Pantothenate kinase 2 [Morus notabilis] Length = 912 Score = 95.9 bits (237), Expect = 5e-18 Identities = 53/61 (86%), Positives = 54/61 (88%), Gaps = 4/61 (6%) Frame = +2 Query: 185 MAPPV---IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDI-SHLALDIGGSLIKL 352 MAPP IHRSSSRPQLD+S AAIQGN EERDPTILLPNQSDDI SHLALDIGGSLIKL Sbjct: 43 MAPPAGSSIHRSSSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISSHLALDIGGSLIKL 102 Query: 353 V 355 V Sbjct: 103 V 103 >gb|EPS64631.1| hypothetical protein M569_10149, partial [Genlisea aurea] Length = 601 Score = 95.9 bits (237), Expect = 5e-18 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 I RSSSRPQLD+SGAAIQGN EER+PTILLPNQSDDISHLALDIGGSLIKLV Sbjct: 48 IRRSSSRPQLDLSGAAIQGNFEERNPTILLPNQSDDISHLALDIGGSLIKLV 99 >ref|XP_007210380.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica] gi|462406115|gb|EMJ11579.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica] Length = 910 Score = 95.5 bits (236), Expect = 7e-18 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S AAIQGN EERDPTILLPNQSDD+SHLALDIGGSLIKLV Sbjct: 50 IHRSGSRPQLDLSKAAIQGNFEERDPTILLPNQSDDLSHLALDIGGSLIKLV 101 >ref|XP_002511391.1| Pantothenate kinase, putative [Ricinus communis] gi|223550506|gb|EEF51993.1| Pantothenate kinase, putative [Ricinus communis] Length = 907 Score = 95.5 bits (236), Expect = 7e-18 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S AAIQGN EERDPTILLPNQSDDISHLALDIGGSLIKLV Sbjct: 47 IHRSGSRPQLDLSKAAIQGNSEERDPTILLPNQSDDISHLALDIGGSLIKLV 98 >ref|XP_002867254.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata] gi|297313090|gb|EFH43513.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata] Length = 902 Score = 95.1 bits (235), Expect = 9e-18 Identities = 51/63 (80%), Positives = 53/63 (84%), Gaps = 4/63 (6%) Frame = +2 Query: 179 RLMAPPV----IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLI 346 R MAP IHRS SRPQLD+S A IQGNLEERDPTILLPNQSDDISHLALDIGGSLI Sbjct: 31 RDMAPSTSGTSIHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLI 90 Query: 347 KLV 355 KL+ Sbjct: 91 KLL 93 >gb|AAM20690.1| putative protein [Arabidopsis thaliana] Length = 870 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S A IQGNLEERDPTILLPNQSDDISHLALDIGGSLIKL+ Sbjct: 10 IHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLL 61 >ref|XP_006282554.1| hypothetical protein CARUB_v10004099mg [Capsella rubella] gi|482551259|gb|EOA15452.1| hypothetical protein CARUB_v10004099mg [Capsella rubella] Length = 905 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S A IQGNLEERDPTILLPNQSDDISHLALDIGGSLIKL+ Sbjct: 45 IHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLL 96 >ref|XP_004152477.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus] gi|449520489|ref|XP_004167266.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus] Length = 911 Score = 94.7 bits (234), Expect = 1e-17 Identities = 51/62 (82%), Positives = 52/62 (83%), Gaps = 3/62 (4%) Frame = +2 Query: 179 RLMAPPV---IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIK 349 R MAP IHRS SRPQLD+S A IQGN EERDPTILLPNQSDDISHLALDIGGSLIK Sbjct: 40 RDMAPVTGNSIHRSGSRPQLDLSKAEIQGNFEERDPTILLPNQSDDISHLALDIGGSLIK 99 Query: 350 LV 355 LV Sbjct: 100 LV 101 >ref|NP_001031768.1| pantothenate kinase 2 [Arabidopsis thaliana] gi|186515428|ref|NP_001119092.1| pantothenate kinase 2 [Arabidopsis thaliana] gi|332660616|gb|AEE86016.1| pantothenate kinase 2 [Arabidopsis thaliana] gi|332660617|gb|AEE86017.1| pantothenate kinase 2 [Arabidopsis thaliana] Length = 783 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S A IQGNLEERDPTILLPNQSDDISHLALDIGGSLIKL+ Sbjct: 41 IHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLL 92 >ref|NP_194945.3| pantothenate kinase 2 [Arabidopsis thaliana] gi|334302844|sp|Q8L5Y9.2|PANK2_ARATH RecName: Full=Pantothenate kinase 2; AltName: Full=Pantothenic acid kinase 2 gi|332660615|gb|AEE86015.1| pantothenate kinase 2 [Arabidopsis thaliana] Length = 901 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S A IQGNLEERDPTILLPNQSDDISHLALDIGGSLIKL+ Sbjct: 41 IHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLL 92 >pir||T05410 hypothetical protein F10M6.180 - Arabidopsis thaliana gi|2864625|emb|CAA16972.1| putative protein [Arabidopsis thaliana] gi|7270122|emb|CAB79936.1| putative protein [Arabidopsis thaliana] Length = 838 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S A IQGNLEERDPTILLPNQSDDISHLALDIGGSLIKL+ Sbjct: 41 IHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLL 92 >ref|XP_006412505.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum] gi|557113675|gb|ESQ53958.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum] Length = 901 Score = 93.2 bits (230), Expect = 3e-17 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+S A IQGN EERDPTILLPNQSDDISHLALDIGGSLIKL+ Sbjct: 38 IHRSGSRPQLDLSKAEIQGNFEERDPTILLPNQSDDISHLALDIGGSLIKLL 89 >ref|XP_003576771.1| PREDICTED: pantothenate kinase 2-like [Brachypodium distachyon] Length = 912 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +2 Query: 197 VIHRSSSRPQLDVSGAAIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 ++HRS SRPQLD+SGAAI G LE+R+PTILLPNQSDDISHLALDIGGSLIKLV Sbjct: 41 MLHRSGSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLV 93 >emb|CBI15019.3| unnamed protein product [Vitis vinifera] Length = 988 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = +2 Query: 200 IHRSSSRPQLDVSGAAIQGN-LEERDPTILLPNQSDDISHLALDIGGSLIKLV 355 IHRS SRPQLD+SGAAIQGN EER PTILLPNQSDDISHLALDIGGSLIKLV Sbjct: 9 IHRSGSRPQLDLSGAAIQGNNFEERHPTILLPNQSDDISHLALDIGGSLIKLV 61